BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0827 (552 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g15880.1 68415.m01820 leucine-rich repeat family protein / ex... 31 0.39 At3g08790.1 68416.m01021 VHS domain-containing protein / GAT dom... 31 0.68 At1g03103.1 68414.m00286 protease inhibitor/seed storage/lipid t... 31 0.68 At2g35670.1 68415.m04375 transcription factor, putative / fertil... 30 0.89 At3g24690.1 68416.m03100 expressed protein similar to hypothetic... 29 1.6 At5g07940.1 68418.m00920 expressed protein 28 4.8 At4g29310.1 68417.m04190 expressed protein 28 4.8 At3g54590.1 68416.m06040 proline-rich extensin-like family prote... 28 4.8 At4g13390.1 68417.m02092 proline-rich extensin-like family prote... 27 6.3 At3g18360.1 68416.m02335 VQ motif-containing protein contains PF... 27 6.3 At2g24980.1 68415.m02987 proline-rich extensin-like family prote... 27 6.3 At5g09280.1 68418.m01075 pectate lyase family protein similar to... 27 8.3 At3g57860.1 68416.m06450 expressed protein 27 8.3 At3g43610.1 68416.m04640 tubulin family protein 27 8.3 At3g10720.2 68416.m01291 pectinesterase, putative contains simil... 27 8.3 >At2g15880.1 68415.m01820 leucine-rich repeat family protein / extensin family protein similar to extensin-like protein [Lycopersicon esculentum] gi|5917664|gb|AAD55979; contains leucine-rich repeats, Pfam:PF00560; contains proline rich extensin domains, INTERPRO:IPR002965 Length = 727 Score = 31.5 bits (68), Expect = 0.39 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -2 Query: 239 RPQHHL-HSNPPFSIFPTAPPANQFYSP 159 +P HH+ HS PP S PT+PP + SP Sbjct: 438 QPHHHVVHSPPPASSPPTSPPVHSTPSP 465 >At3g08790.1 68416.m01021 VHS domain-containing protein / GAT domain-containing protein weak similarity to HGF-regulated tyrosine kinase substrate [Mus musculus] GI:1089781; contains Pfam profiles PF00790: VHS domain, PF03127: GAT domain Length = 607 Score = 30.7 bits (66), Expect = 0.68 Identities = 15/47 (31%), Positives = 25/47 (53%), Gaps = 1/47 (2%) Frame = -2 Query: 263 LWNQRVRFRPQHHLHSNPPFSIFPT-APPANQFYSPRRRSFLNVGPP 126 +WN ++ +P + N PFS P +PPA+ Y + + L + PP Sbjct: 399 VWNLQITQQPSSPAYGNQPFS--PNFSPPASPHYGGQNNNVLALPPP 443 >At1g03103.1 68414.m00286 protease inhibitor/seed storage/lipid transfer protein (LTP) family protein contains Pfam profile PF00234:Protease inhibitor/seed storage/LTP family; low similarity to SP:Q42978 Nonspecific lipid-transfer protein 2 precursor (LTP 2) {Oryza sativa} Length = 171 Score = 30.7 bits (66), Expect = 0.68 Identities = 23/71 (32%), Positives = 34/71 (47%) Frame = -1 Query: 381 GTSSWA*ACTRGFSPFTESAEACCSSQRYKLAVCFYGIKTMESTCALPTPAPSPLESAVF 202 G+SS + +C R FS +S+ C S FYG K T AL P +++ Sbjct: 42 GSSSPSWSCCRQFSTVVQSSPECLCSVVNSNESSFYGFK-FNRTLALNLPTACNVQTP-- 98 Query: 201 NFSNCSTGKSV 169 + S C+TG +V Sbjct: 99 SPSLCNTGGNV 109 >At2g35670.1 68415.m04375 transcription factor, putative / fertilization-independent seed 2 protein (FIS2) identical to GB:AF096095 Length = 632 Score = 30.3 bits (65), Expect = 0.89 Identities = 20/76 (26%), Positives = 33/76 (43%) Frame = +2 Query: 311 QHASADSVNGEKPRVHAQAQLDVPSEGVHRVLENDGSHVSVHDVTSPPTAAAYEVTPKVF 490 Q D N K +LD+ + + R END +HV+ +V+SPP A + E + Sbjct: 87 QRRQRDDSNNVKKLNVLLMELDL--DDLPRGTENDSTHVNDDNVSSPPRAHSSEKISDIL 144 Query: 491 HGAARLSSQARRPSAP 538 +++ P P Sbjct: 145 TTTQLAIAESSEPKVP 160 >At3g24690.1 68416.m03100 expressed protein similar to hypothetical protein GB:AAB61487 from [Arabidopsis thaliana] Length = 158 Score = 29.5 bits (63), Expect = 1.6 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 1/47 (2%) Frame = +2 Query: 404 LENDGSHVSVH-DVTSPPTAAAYEVTPKVFHGAARLSSQARRPSAPQ 541 + +DG + V D TSP + ++ VTP AR A++P PQ Sbjct: 112 ISDDGINSEVSKDDTSPSSESSQGVTPSPLSRKARRKRNAKKPQIPQ 158 >At5g07940.1 68418.m00920 expressed protein Length = 1526 Score = 27.9 bits (59), Expect = 4.8 Identities = 19/68 (27%), Positives = 29/68 (42%), Gaps = 4/68 (5%) Frame = -2 Query: 353 PVVSHRSPSQLKRVALVRDTSSPFAFMASRLWNQRVRFRP----QHHLHSNPPFSIFPTA 186 P+V+ SP Q ++ D+ S + + WNQ + +P H L SN + F Sbjct: 994 PLVASSSPQQSSSSGMMSDSPSGISAPQHQFWNQPSKPQPVILRPHPLPSNNMAASFSRQ 1053 Query: 185 PPANQFYS 162 NQ S Sbjct: 1054 EKTNQLSS 1061 >At4g29310.1 68417.m04190 expressed protein Length = 424 Score = 27.9 bits (59), Expect = 4.8 Identities = 14/36 (38%), Positives = 22/36 (61%), Gaps = 1/36 (2%) Frame = +2 Query: 407 ENDGSHVSVHDVTSPPTAAAYEVTPKVFH-GAARLS 511 E G +++HD++ P AAA +TP V G+ R+S Sbjct: 231 ERKGWMITIHDLSGSPVAAASMITPFVASPGSDRVS 266 >At3g54590.1 68416.m06040 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 743 Score = 27.9 bits (59), Expect = 4.8 Identities = 12/40 (30%), Positives = 21/40 (52%) Frame = -2 Query: 236 PQHHLHSNPPFSIFPTAPPANQFYSPRRRSFLNVGPPAHI 117 P+ H S PP ++ + PP +YSP + + PP ++ Sbjct: 564 PKVHYKSPPPPYVYNSPPPP--YYSPSPKVYYKSPPPPYV 601 >At4g13390.1 68417.m02092 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 429 Score = 27.5 bits (58), Expect = 6.3 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = -2 Query: 236 PQHHLHSNPPFSIFPTAPPANQFYSPRRRSFLNVGPPAHI 117 P+ S PP ++ + PP +YSP + N PP +I Sbjct: 117 PKVEYKSPPPPYVYSSLPPLT-YYSPSPKVIYNSPPPPYI 155 >At3g18360.1 68416.m02335 VQ motif-containing protein contains PF05678: VQ motif Length = 285 Score = 27.5 bits (58), Expect = 6.3 Identities = 19/57 (33%), Positives = 23/57 (40%) Frame = -2 Query: 212 PPFSIFPTAPPANQFYSPRRRSFLNVGPPAHIRPDASS*VSARKSVDESIALYCRDF 42 P F IFP A PA+ F + F N P P+ S S+ S RDF Sbjct: 230 PTFPIFPPANPADNFLC-GNQPFANFDDPLFFAPNMRSSFSSSSSSGFDGLTEFRDF 285 >At2g24980.1 68415.m02987 proline-rich extensin-like family protein contains proline-rich extensin domains, INTERPRO:IPR002965 Length = 559 Score = 27.5 bits (58), Expect = 6.3 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = -2 Query: 236 PQHHLHSNPPFSIFPTAPPANQFYSPRRRSFLNVGPPAHI 117 P+ + S PP ++ + PP +YSP + + PP+++ Sbjct: 466 PKVYYKSPPPSYVYSSPPPP--YYSPSPKVYYKSPPPSYV 503 >At5g09280.1 68418.m01075 pectate lyase family protein similar to major pollen allergen Cup a 1 SP:Q9SCG9 from [Cupressus arizonica] Length = 297 Score = 27.1 bits (57), Expect = 8.3 Identities = 14/44 (31%), Positives = 19/44 (43%) Frame = +2 Query: 413 DGSHVSVHDVTSPPTAAAYEVTPKVFHGAARLSSQARRPSAPQG 544 DG SVH ++ P Y T + HG +A PS+ G Sbjct: 65 DGRGASVH-ISGPACLIVYRATDVIIHGLKIHDCKAHPPSSVMG 107 >At3g57860.1 68416.m06450 expressed protein Length = 243 Score = 27.1 bits (57), Expect = 8.3 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 404 GRGEHLPKARPAGLERVPVVSHR 336 GRG H P P G E +P+V+ R Sbjct: 68 GRGGHTPFRLPQGRENMPIVTAR 90 >At3g43610.1 68416.m04640 tubulin family protein Length = 1120 Score = 27.1 bits (57), Expect = 8.3 Identities = 23/81 (28%), Positives = 33/81 (40%), Gaps = 1/81 (1%) Frame = -1 Query: 351 RGFSPFTESAEACCSSQRYKLAVCFYGIKTMESTCALPTP-APSPLESAVFNFSNCSTGK 175 R FS S + CSS R L G+ +ST P P S L +V + NC+ Sbjct: 508 RWFSEIDASCSSECSSTRDSLEASEVGLLDSQSTLVGPPPNYLSALRFSVASNGNCNQ-N 566 Query: 174 SVLFSEASFVSECWATGAHKA 112 V S++ ++ KA Sbjct: 567 LVQHSDSGYIDNNLVRQGEKA 587 >At3g10720.2 68416.m01291 pectinesterase, putative contains similarity to pectinesterase from Vitis vinifera GI:15081598, Prunus persica SP|Q43062; contains Pfam profile PF01095 pectinesterase Length = 619 Score = 27.1 bits (57), Expect = 8.3 Identities = 21/73 (28%), Positives = 30/73 (41%) Frame = -2 Query: 221 HSNPPFSIFPTAPPANQFYSPRRRSFLNVGPPAHIRPDASS*VSARKSVDESIALYCRDF 42 HS PP S P PP + P + PP + P + +S S+A + Sbjct: 36 HSEPP-SQLPFEPPVESPFFPPSQ------PPIFVPPSQPPSLPPSQSQSPSLACKSTPY 88 Query: 41 PRR*RSSENAVSS 3 P+ R+ NAV S Sbjct: 89 PKLCRTILNAVKS 101 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,335,907 Number of Sequences: 28952 Number of extensions: 265533 Number of successful extensions: 925 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 815 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 922 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1043173136 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -