BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0822 (595 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 07_01_0549 + 4082672-4082731,4083424-4083489,4083628-4083674,408... 29 3.7 02_05_0622 + 30437533-30437577,30437694-30438177,30438301-304383... 28 6.5 04_01_0069 - 697811-697876,697956-698166,698265-698359,698448-69... 27 8.5 >07_01_0549 + 4082672-4082731,4083424-4083489,4083628-4083674, 4083757-4083802,4083905-4083985,4084105-4084147, 4084258-4084307,4084392-4084473,4084538-4084587, 4084687-4084760,4084870-4084921,4085034-4085459, 4085816-4086403 Length = 554 Score = 28.7 bits (61), Expect = 3.7 Identities = 23/80 (28%), Positives = 35/80 (43%), Gaps = 1/80 (1%) Frame = +1 Query: 13 VCVVLAQALTDEQKENLKKHRADCLAETKADEQLVNKLKTGDFKTENEPLKKYALCMLIK 192 VC+V+ + E +KK ++ +E + LV L D+ N L + C I Sbjct: 46 VCIVIGYCEGGDMSEAIKKANSNYFSEERLCMWLVQLLMALDYLHVNHILHRDVKCSNI- 104 Query: 193 SQLMTKDGKFK-KDVALAKV 249 +TKD + D LAKV Sbjct: 105 --FLTKDQNIRLGDFGLAKV 122 >02_05_0622 + 30437533-30437577,30437694-30438177,30438301-30438354, 30438565-30438789,30438891-30438943,30439591-30439714, 30439823-30440077,30440171-30440517,30440661-30441266, 30441504-30441546,30441624-30441757 Length = 789 Score = 27.9 bits (59), Expect = 6.5 Identities = 16/60 (26%), Positives = 31/60 (51%), Gaps = 1/60 (1%) Frame = -3 Query: 314 VAFVGQAS-VNQLLYFQFVFSLGTLARATSFLNFPSLVISCDLISIHRAYFFNGSFSVLK 138 +A++GQA+ ++Q F+ + +G L +P LVI+ + G+FS++K Sbjct: 300 LAYMGQAAYISQHHSFENAYHIGFYVSVPEKLRWPVLVIAILAAVVGSQAVITGTFSIIK 359 >04_01_0069 - 697811-697876,697956-698166,698265-698359,698448-698513, 698595-698643,698720-698770,698856-698908,699263-699331, 699874-699928,700011-700099,700217-700302,700376-700432, 700575-700716,701637-702032 Length = 494 Score = 27.5 bits (58), Expect = 8.5 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = +3 Query: 150 KRTIEEVRSMYADQIAADDQGREIQE 227 K T+EE+ S+Y ++ DD+ E QE Sbjct: 295 KETMEEIESLYDEESRLDDEIMEAQE 320 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,801,328 Number of Sequences: 37544 Number of extensions: 312884 Number of successful extensions: 767 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 749 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 767 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1411925004 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -