BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0820 (656 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q89GH5 Cluster: ABC transporter permease protein; n=1; ... 33 6.0 UniRef50_A6SGR7 Cluster: Putative uncharacterized protein; n=1; ... 33 8.0 >UniRef50_Q89GH5 Cluster: ABC transporter permease protein; n=1; Bradyrhizobium japonicum|Rep: ABC transporter permease protein - Bradyrhizobium japonicum Length = 288 Score = 33.1 bits (72), Expect = 6.0 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = +2 Query: 194 FLTYITEAFTALPYIIII*IASWENCELQ*LFEMFSVNR-*NSHLDILYL 340 +L Y + AF PY+I + +A+ L LFE F ++R N HL L L Sbjct: 48 YLAYSSMAFLGAPYLIAVIVAALGTAALGYLFERFLLDRLVNDHLSTLML 97 >UniRef50_A6SGR7 Cluster: Putative uncharacterized protein; n=1; Botryotinia fuckeliana B05.10|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 757 Score = 32.7 bits (71), Expect = 8.0 Identities = 25/67 (37%), Positives = 36/67 (53%), Gaps = 2/67 (2%) Frame = +1 Query: 352 IHATSNLKSVTLVYSKRNIQSYHIKLTQNM--I*TYLCNLKESKI*TKLRTPHFRVHHII 525 + AT +SVT SK N ++Y+IK T + +CNL ++K KLR HF+ H Sbjct: 409 VTATDTRESVTYTVSKANAEAYNIKQTHVVAGFSCPICNL-DTKSMEKLRL-HFKTTH-- 464 Query: 526 KYRF*LH 546 +RF H Sbjct: 465 -FRFTFH 470 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 597,694,570 Number of Sequences: 1657284 Number of extensions: 11390230 Number of successful extensions: 19206 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 18579 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 19185 length of database: 575,637,011 effective HSP length: 98 effective length of database: 413,223,179 effective search space used: 49586781480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -