BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0820 (656 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0662 - 27051508-27051828,27051878-27053438,27054333-27054733 28 7.5 >04_04_0662 - 27051508-27051828,27051878-27053438,27054333-27054733 Length = 760 Score = 27.9 bits (59), Expect = 7.5 Identities = 17/64 (26%), Positives = 35/64 (54%), Gaps = 1/64 (1%) Frame = +3 Query: 372 KERHSGVFKKKYTKLSH*INAKYDINISM*SKRIENMNKTK-NAALSCPSHYKI*VLIAH 548 +E SG+ + Y + S K++ NI+ K+++ NK + + +CP +++ V+ Sbjct: 522 EEISSGMRRLGYNRSSKRCKEKWE-NINKYFKKVKESNKKRPEDSKTCPYFHQLDVIYRR 580 Query: 549 KHLS 560 KHL+ Sbjct: 581 KHLT 584 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,136,225 Number of Sequences: 37544 Number of extensions: 278425 Number of successful extensions: 397 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 395 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 397 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1644004708 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -