BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0815 (579 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenin... 25 1.8 AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbona... 25 2.3 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 4.1 AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein p... 24 4.1 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 23 5.4 DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. 23 7.2 DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. 23 7.2 DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. 23 7.2 DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. 23 7.2 DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. 23 7.2 DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. 23 7.2 DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. 23 7.2 DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. 23 7.2 DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. 23 7.2 DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. 23 7.2 DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. 23 7.2 DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. 23 7.2 DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. 23 7.2 DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. 23 7.2 AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. 23 7.2 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 23 7.2 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 23 9.5 AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CY... 23 9.5 >AM042695-1|CAJ14970.1| 396|Anopheles gambiae 3-hydroxykynurenine transaminase protein. Length = 396 Score = 25.0 bits (52), Expect = 1.8 Identities = 10/28 (35%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = +3 Query: 102 CFFRRHLTSEG--LQPEQSIGDLCHRNN 179 C F H S LQP + +G +CH+++ Sbjct: 146 CLFLTHGDSSSGLLQPLEGVGQICHQHD 173 >AY280611-1|AAQ21364.1| 1102|Anopheles gambiae chloride/bicarbonate anion exchanger protein. Length = 1102 Score = 24.6 bits (51), Expect = 2.3 Identities = 11/25 (44%), Positives = 15/25 (60%) Frame = +3 Query: 234 ISYAPIKEATCEPPVDSASLPLEHR 308 +S I E CE V+S +LP+E R Sbjct: 175 VSLEQIAELVCENMVNSGTLPVEAR 199 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.8 bits (49), Expect = 4.1 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 1/38 (2%) Frame = -1 Query: 390 SLGCQVSLMAKDRR-HVLEPRADSSLHPRGAPMVAKLN 280 ++G + ++ A RR HVL+ A H G + A+LN Sbjct: 1151 AMGPRTAMAAGTRRAHVLQRSAGKMFHQWGEALGARLN 1188 >AB090822-1|BAC57919.1| 468|Anopheles gambiae gag-like protein protein. Length = 468 Score = 23.8 bits (49), Expect = 4.1 Identities = 11/23 (47%), Positives = 11/23 (47%) Frame = +3 Query: 258 ATCEPPVDSASLPLEHRAGGGYC 326 ATCE V AS HR G C Sbjct: 440 ATCEAEVRCASCAGPHRMGSAQC 462 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 23.4 bits (48), Expect = 5.4 Identities = 10/19 (52%), Positives = 11/19 (57%) Frame = -2 Query: 92 IDHCSRVHKAQILVTRFTF 36 ID CSR+ Q L TR F Sbjct: 841 IDGCSRIESIQRLFTRVAF 859 >DQ986315-1|ABK59975.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 281 FSFATIGAPRGWRLLSALGSST 346 F F+ G P G+R ++ GS T Sbjct: 194 FLFSDRGTPDGYRFMNGYGSHT 215 >DQ980210-1|ABL09378.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 281 FSFATIGAPRGWRLLSALGSST 346 F F+ G P G+R ++ GS T Sbjct: 194 FLFSDRGTPDGYRFMNGYGSHT 215 >DQ980209-1|ABL09377.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 281 FSFATIGAPRGWRLLSALGSST 346 F F+ G P G+R ++ GS T Sbjct: 194 FLFSDRGTPDGYRFMNGYGSHT 215 >DQ980208-1|ABL09376.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 281 FSFATIGAPRGWRLLSALGSST 346 F F+ G P G+R ++ GS T Sbjct: 194 FLFSDRGTPDGYRFMNGYGSHT 215 >DQ980207-1|ABL09375.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 281 FSFATIGAPRGWRLLSALGSST 346 F F+ G P G+R ++ GS T Sbjct: 194 FLFSDRGTPDGYRFMNGYGSHT 215 >DQ980206-1|ABL09374.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 281 FSFATIGAPRGWRLLSALGSST 346 F F+ G P G+R ++ GS T Sbjct: 194 FLFSDRGTPDGYRFMNGYGSHT 215 >DQ980205-1|ABL09373.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 281 FSFATIGAPRGWRLLSALGSST 346 F F+ G P G+R ++ GS T Sbjct: 194 FLFSDRGTPDGYRFMNGYGSHT 215 >DQ980204-1|ABL09372.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 281 FSFATIGAPRGWRLLSALGSST 346 F F+ G P G+R ++ GS T Sbjct: 194 FLFSDRGTPDGYRFMNGYGSHT 215 >DQ980203-1|ABL09371.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 281 FSFATIGAPRGWRLLSALGSST 346 F F+ G P G+R ++ GS T Sbjct: 194 FLFSDRGTPDGYRFMNGYGSHT 215 >DQ980202-1|ABL09370.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 281 FSFATIGAPRGWRLLSALGSST 346 F F+ G P G+R ++ GS T Sbjct: 194 FLFSDRGTPDGYRFMNGYGSHT 215 >DQ980201-1|ABL09369.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 281 FSFATIGAPRGWRLLSALGSST 346 F F+ G P G+R ++ GS T Sbjct: 194 FLFSDRGTPDGYRFMNGYGSHT 215 >DQ980200-1|ABL09368.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 281 FSFATIGAPRGWRLLSALGSST 346 F F+ G P G+R ++ GS T Sbjct: 194 FLFSDRGTPDGYRFMNGYGSHT 215 >DQ980199-1|ABL09367.1| 504|Anopheles gambiae catalase protein. Length = 504 Score = 23.0 bits (47), Expect = 7.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 281 FSFATIGAPRGWRLLSALGSST 346 F F+ G P G+R ++ GS T Sbjct: 194 FLFSDRGTPDGYRFMNGYGSHT 215 >DQ974166-1|ABJ52806.1| 494|Anopheles gambiae serpin 6 protein. Length = 494 Score = 23.0 bits (47), Expect = 7.2 Identities = 12/28 (42%), Positives = 14/28 (50%), Gaps = 1/28 (3%) Frame = +3 Query: 327 PPLAPAHADDPWPLATPDS-PKIKHLQV 407 PP P +A P TPD+ KI L V Sbjct: 66 PPAPPTNAPSQLPALTPDNDAKISQLVV 93 >AY505416-1|AAR90327.1| 485|Anopheles gambiae catalase 1 protein. Length = 485 Score = 23.0 bits (47), Expect = 7.2 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = +2 Query: 281 FSFATIGAPRGWRLLSALGSST 346 F F+ G P G+R ++ GS T Sbjct: 178 FLFSDRGTPDGYRFMNGYGSHT 199 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 7.2 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 198 DCDDEEDQVDIGISYAPIKEATCEPPVDSASLPLEHRAGGG 320 + + EED V + A K E PV ++ E +GGG Sbjct: 1528 EANSEEDIVPPAPATATTKSVEREEPVRASGKAPESESGGG 1568 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 22.6 bits (46), Expect = 9.5 Identities = 10/32 (31%), Positives = 14/32 (43%) Frame = +3 Query: 249 IKEATCEPPVDSASLPLEHRAGGGYCPPLAPA 344 I ++C P ++S A G CP PA Sbjct: 233 IPVSSCSPLSTASSASCSSSAAGSLCPTSPPA 264 >AF487536-1|AAL93297.1| 504|Anopheles gambiae cytochrome P450 CYP6Y1 protein. Length = 504 Score = 22.6 bits (46), Expect = 9.5 Identities = 9/21 (42%), Positives = 12/21 (57%) Frame = +1 Query: 271 LLWIQLRYHWSTARVEATVRP 333 L WI RYH+ R A ++P Sbjct: 17 LAWIHRRYHFWKDRSVAYIKP 37 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 583,640 Number of Sequences: 2352 Number of extensions: 10901 Number of successful extensions: 43 Number of sequences better than 10.0: 23 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 43 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55086417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -