BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0810 (562 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g05660.1 68418.m00622 zinc finger (NF-X1 type) family protein... 28 3.7 At5g18770.1 68418.m02230 F-box family protein contains F-box dom... 27 8.6 >At5g05660.1 68418.m00622 zinc finger (NF-X1 type) family protein contains PF01422: NF-X1 type zinc finger Length = 912 Score = 28.3 bits (60), Expect = 3.7 Identities = 13/47 (27%), Positives = 18/47 (38%) Frame = +2 Query: 233 TIYSLPCMARVRQRVTRCRVPTAASPTVEYDALAAPRVLACGTRPPC 373 T + +PC Q+ RCR +P + P G PPC Sbjct: 467 THFEVPCGTETNQKPPRCRKLCHITPLCRHGQNQKPHKCHYGACPPC 513 >At5g18770.1 68418.m02230 F-box family protein contains F-box domain Pfam:PF00646 Length = 481 Score = 27.1 bits (57), Expect = 8.6 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +1 Query: 433 LVEHYIHICVQTISDTNLKFIYQIHNRQSLARLRRL 540 L+ ++ + TIS T LKFI++ H+ L + R L Sbjct: 300 LLNNFSGVRNMTISWTTLKFIHRFHDMNPLPKFRDL 335 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,782,238 Number of Sequences: 28952 Number of extensions: 161110 Number of successful extensions: 333 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 331 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 333 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1072696904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -