BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0809 (452 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P... 25 0.94 AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical prote... 25 1.6 AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical prote... 25 1.6 AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. 24 2.2 AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleo... 24 2.2 EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhy... 23 6.7 M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles ... 22 8.8 >AY183375-1|AAO24765.1| 679|Anopheles gambiae NADPH cytochrome P450 reductase protein. Length = 679 Score = 25.4 bits (53), Expect = 0.94 Identities = 9/21 (42%), Positives = 15/21 (71%) Frame = +1 Query: 295 SSFLNPILFTNRRMVIFYGRQ 357 +SF+ + + RR+V+FYG Q Sbjct: 70 NSFIKKLQSSGRRLVVFYGSQ 90 >AJ439060-1|CAD27752.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 24.6 bits (51), Expect = 1.6 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = +3 Query: 336 GDFLRA--AGP*SRRDQHVESYYERQSHDRDVH 428 GDF+ A GP S D+H E ++QS + H Sbjct: 453 GDFVDAFFRGPDSGTDRHSEKQQQQQSQHQQQH 485 >AJ438610-9|CAD27481.1| 763|Anopheles gambiae hypothetical protein protein. Length = 763 Score = 24.6 bits (51), Expect = 1.6 Identities = 13/33 (39%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = +3 Query: 336 GDFLRA--AGP*SRRDQHVESYYERQSHDRDVH 428 GDF+ A GP S D+H E ++QS + H Sbjct: 453 GDFVDAFFRGPDSGTDRHSEKQQQQQSQHQQQH 485 >AY578799-1|AAT07304.1| 679|Anopheles gambiae brinker protein. Length = 679 Score = 24.2 bits (50), Expect = 2.2 Identities = 12/41 (29%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = -3 Query: 441 SITARERRDRATGVRNTI--QRVDHGDFTVLPPVKNHHPSI 325 S+ A +R G++ + H LP V+ HHPS+ Sbjct: 98 SVVANGNANREAGMKINLLNHHQHHHQHPHLPHVQQHHPSV 138 >AJ237706-1|CAB40347.1| 570|Anopheles gambiae putative 5'-nucleotidase protein. Length = 570 Score = 24.2 bits (50), Expect = 2.2 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = +3 Query: 237 GDTKDRLIKNHKHLKVINNKQFFKSDLIYESKDGDF 344 GD D ++ H H ++N D Y++ +GD+ Sbjct: 243 GDLIDVIVGAHSHSLLLNKDAKVPYDTKYDTIEGDY 278 >EF065522-1|ABK59322.1| 255|Anopheles gambiae beta carbonic anhydrase protein. Length = 255 Score = 22.6 bits (46), Expect = 6.7 Identities = 9/30 (30%), Positives = 17/30 (56%) Frame = +3 Query: 255 LIKNHKHLKVINNKQFFKSDLIYESKDGDF 344 ++ N KH+ V + +L+Y+ KD +F Sbjct: 90 VVNNIKHIIVCGHSDCKAMNLLYKLKDPEF 119 >M93689-2|AAA29367.1| 975|Anopheles gambiae protein ( Anopheles gambiae T1 retroposon. ). Length = 975 Score = 22.2 bits (45), Expect = 8.8 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -1 Query: 389 FNVLITATLRSCRP 348 FN L+T+ L SC P Sbjct: 312 FNALLTSALLSCTP 325 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 431,026 Number of Sequences: 2352 Number of extensions: 8189 Number of successful extensions: 14 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 38694201 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -