BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0809 (452 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE013599-1123|AAF58778.4| 963|Drosophila melanogaster CG12052-P... 27 8.9 AB107345-1|BAC67650.1| 963|Drosophila melanogaster Lola protein... 27 8.9 AB107325-1|BAC67630.1| 963|Drosophila melanogaster Lola protein... 27 8.9 AB107305-1|BAC67610.1| 963|Drosophila melanogaster Lola protein... 27 8.9 AB107285-1|BAC67590.1| 963|Drosophila melanogaster Lola protein... 27 8.9 >AE013599-1123|AAF58778.4| 963|Drosophila melanogaster CG12052-PP, isoform P protein. Length = 963 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 146 EAPKII*SCLRRYSMEIKLKCHLKLKTFVP 235 E P + +C R Y + LKCHLK + +P Sbjct: 846 EKPWVCRNCNRTYKWKNSLKCHLKNECGLP 875 >AB107345-1|BAC67650.1| 963|Drosophila melanogaster Lola protein isoform N protein. Length = 963 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 146 EAPKII*SCLRRYSMEIKLKCHLKLKTFVP 235 E P + +C R Y + LKCHLK + +P Sbjct: 846 EKPWVCRNCNRTYKWKNSLKCHLKNECGLP 875 >AB107325-1|BAC67630.1| 963|Drosophila melanogaster Lola protein isoform N protein. Length = 963 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 146 EAPKII*SCLRRYSMEIKLKCHLKLKTFVP 235 E P + +C R Y + LKCHLK + +P Sbjct: 846 EKPWVCRNCNRTYKWKNSLKCHLKNECGLP 875 >AB107305-1|BAC67610.1| 963|Drosophila melanogaster Lola protein isoform N protein. Length = 963 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 146 EAPKII*SCLRRYSMEIKLKCHLKLKTFVP 235 E P + +C R Y + LKCHLK + +P Sbjct: 846 EKPWVCRNCNRTYKWKNSLKCHLKNECGLP 875 >AB107285-1|BAC67590.1| 963|Drosophila melanogaster Lola protein isoform N protein. Length = 963 Score = 27.5 bits (58), Expect = 8.9 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +2 Query: 146 EAPKII*SCLRRYSMEIKLKCHLKLKTFVP 235 E P + +C R Y + LKCHLK + +P Sbjct: 846 EKPWVCRNCNRTYKWKNSLKCHLKNECGLP 875 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,050,922 Number of Sequences: 53049 Number of extensions: 333184 Number of successful extensions: 889 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 876 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 889 length of database: 24,988,368 effective HSP length: 79 effective length of database: 20,797,497 effective search space used: 1476622287 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -