BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0800 (596 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory recept... 22 3.4 AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory recept... 22 3.4 AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory recept... 21 6.0 AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory recept... 21 6.0 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 21 7.9 >AM292376-1|CAL23188.2| 402|Tribolium castaneum gustatory receptor candidate 55 protein. Length = 402 Score = 22.2 bits (45), Expect = 3.4 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 64 LLRNYQDFFYLCKQGTVYT*LHPMSNFRVA 153 L ++ D+FY T YT L S FR+A Sbjct: 48 LKQHKSDYFYFSFYITSYTLLSVYSLFRIA 77 >AM292332-1|CAL23144.2| 344|Tribolium castaneum gustatory receptor candidate 11 protein. Length = 344 Score = 22.2 bits (45), Expect = 3.4 Identities = 12/30 (40%), Positives = 16/30 (53%) Frame = +1 Query: 64 LLRNYQDFFYLCKQGTVYT*LHPMSNFRVA 153 L ++ D+FY T YT L S FR+A Sbjct: 48 LKQHKSDYFYFSFYITSYTLLSVYSLFRIA 77 >AM292360-1|CAL23172.2| 427|Tribolium castaneum gustatory receptor candidate 39 protein. Length = 427 Score = 21.4 bits (43), Expect = 6.0 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +1 Query: 454 PTKAITDPLPSPTKIAQQENYY 519 PT A D P P + + +N+Y Sbjct: 29 PTSANPDEEPDPELLDRYDNFY 50 >AM292331-1|CAL23143.2| 437|Tribolium castaneum gustatory receptor candidate 10 protein. Length = 437 Score = 21.4 bits (43), Expect = 6.0 Identities = 8/22 (36%), Positives = 12/22 (54%) Frame = +1 Query: 454 PTKAITDPLPSPTKIAQQENYY 519 PT A D P P + + +N+Y Sbjct: 29 PTSANPDEEPDPELLDRYDNFY 50 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 21.0 bits (42), Expect = 7.9 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = +3 Query: 378 YLNAALNMPATNTPGKPGISP 440 +++A +N P+ + P ISP Sbjct: 186 FISALVNAPSVSPASLPSISP 206 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 145,038 Number of Sequences: 336 Number of extensions: 3330 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15039504 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -