BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0800 (596 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 21 6.9 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 21 9.2 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 9.2 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 9.2 AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine rece... 21 9.2 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 21.4 bits (43), Expect = 6.9 Identities = 10/27 (37%), Positives = 16/27 (59%) Frame = -2 Query: 403 GIFSAALR*IYHSCKNFRITSHSRFFV 323 GIF AL + ++ +TSHS ++V Sbjct: 253 GIFGMALSPVTNNLYYSPLTSHSLYYV 279 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 21.0 bits (42), Expect = 9.2 Identities = 11/48 (22%), Positives = 22/48 (45%) Frame = -2 Query: 523 ANSNSLVVQF*LAKAKDQLLPLLVMDVLGDIPGLPGVFVAGIFSAALR 380 +NSN ++ + + + + + + L +I P GIF+ LR Sbjct: 461 SNSNQFILMTTVNEGNNNMAATYMNECLLNIQKSPRTLTLGIFAEKLR 508 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 21.0 bits (42), Expect = 9.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 534 NALSPIVILLLCNFSWRRQRISY 466 N L IL +CN WR R++Y Sbjct: 44 NTLISNDILPVCNGLWRWIRLTY 66 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 21.0 bits (42), Expect = 9.2 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -3 Query: 534 NALSPIVILLLCNFSWRRQRISY 466 N L IL +CN WR R++Y Sbjct: 82 NTLISNDILPVCNGLWRWIRLTY 104 >AY921573-1|AAX62923.1| 694|Apis mellifera D2-like dopamine receptor protein. Length = 694 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = -1 Query: 374 LPFL*KFQNNFTFTVFRSRFKKKYN 300 L ++ F N +TVF F+K ++ Sbjct: 665 LGYMNSFVNPVIYTVFNPEFRKAFH 689 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 168,344 Number of Sequences: 438 Number of extensions: 3431 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -