BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0800 (596 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g15070.1 68417.m02315 DC1 domain-containing protein contains ... 27 7.2 >At4g15070.1 68417.m02315 DC1 domain-containing protein contains Pfam profile PF03107: DC1 domain Length = 889 Score = 27.5 bits (58), Expect = 7.2 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = -1 Query: 332 VFRSRFKKKYNVYLFSLGFKINLHISCLLGFHILY 228 V + K K Y+ + LHI C+LG +LY Sbjct: 845 VCEKKIKSKERFYMCDEYCCVTLHIECMLGVDLLY 879 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,590,748 Number of Sequences: 28952 Number of extensions: 256864 Number of successful extensions: 498 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 498 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1190791976 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -