BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0791 (455 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 38 2e-04 AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. 35 0.002 AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. 35 0.002 AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. 35 0.002 AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. 35 0.002 AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical prote... 25 1.7 AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical prot... 25 1.7 AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcript... 24 2.9 AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 pr... 23 5.1 EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calc... 22 8.9 AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcript... 22 8.9 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 37.9 bits (84), Expect = 2e-04 Identities = 24/61 (39%), Positives = 26/61 (42%) Frame = +1 Query: 4 WSTASSLMARCPQTRPSGVETILSTLSSARPELASTYPVXXXXXXXXXXXXXXXXAHTDS 183 WS AS+ RCP+TR S ST SS R AST PV A T S Sbjct: 26 WSMASNRTVRCPRTRRSEAVMTRSTPSSPRLAQASTCPVPCSSIWSRPSSMRCAPARTAS 85 Query: 184 C 186 C Sbjct: 86 C 86 >AY334011-1|AAR01136.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 34.7 bits (76), Expect = 0.002 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +2 Query: 257 GKEIVDLVLDRIRKLADQCTGLQGFLIFH 343 G E+VD VLD +RK + C LQGF + H Sbjct: 5 GAELVDAVLDVVRKECENCDCLQGFQLTH 33 >AY334010-1|AAR01135.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 34.7 bits (76), Expect = 0.002 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +2 Query: 257 GKEIVDLVLDRIRKLADQCTGLQGFLIFH 343 G E+VD VLD +RK + C LQGF + H Sbjct: 5 GAELVDAVLDVVRKECENCDCLQGFQLTH 33 >AY334009-1|AAR01134.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 34.7 bits (76), Expect = 0.002 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +2 Query: 257 GKEIVDLVLDRIRKLADQCTGLQGFLIFH 343 G E+VD VLD +RK + C LQGF + H Sbjct: 5 GAELVDAVLDVVRKECENCDCLQGFQLTH 33 >AY334008-1|AAR01133.1| 188|Anopheles gambiae beta-tubulin protein. Length = 188 Score = 34.7 bits (76), Expect = 0.002 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +2 Query: 257 GKEIVDLVLDRIRKLADQCTGLQGFLIFH 343 G E+VD VLD +RK + C LQGF + H Sbjct: 5 GAELVDAVLDVVRKECENCDCLQGFQLTH 33 >AJ439060-3|CAD27754.1| 1645|Anopheles gambiae hypothetical protein protein. Length = 1645 Score = 24.6 bits (51), Expect = 1.7 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -2 Query: 448 RGKWRTPV*TSCRSQRRDRSINKKGEPRAGTSTE 347 RGK R + +S QR + KGEP +GT E Sbjct: 295 RGKRRNTIASS--DQREIAEVINKGEPESGTVEE 326 >AJ438610-11|CAD27483.1| 765|Anopheles gambiae hypothetical protein protein. Length = 765 Score = 24.6 bits (51), Expect = 1.7 Identities = 14/34 (41%), Positives = 18/34 (52%) Frame = -2 Query: 448 RGKWRTPV*TSCRSQRRDRSINKKGEPRAGTSTE 347 RGK R + +S QR + KGEP +GT E Sbjct: 296 RGKRRNTIASS--DQREIAEVINKGEPESGTVEE 327 >AB090824-2|BAC57924.1| 1248|Anopheles gambiae reverse transcriptase protein. Length = 1248 Score = 23.8 bits (49), Expect = 2.9 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = +1 Query: 34 CPQTRPSGVETILSTLSSARPELAS 108 C RPS ++ ++ S RP+LA+ Sbjct: 164 CGSARPSRIDVAFASPSICRPDLAA 188 >AY028784-1|AAK32958.2| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 23.0 bits (47), Expect = 5.1 Identities = 9/19 (47%), Positives = 10/19 (52%) Frame = +2 Query: 56 GWRRFFQHFLQRDRSWQAR 112 GW + HF QR R W R Sbjct: 12 GWLWIYLHFNQRYRFWVER 30 >EF595743-1|ABQ88369.1| 1893|Anopheles gambiae voltage-gated calcium channel alpha1 subunit protein. Length = 1893 Score = 22.2 bits (45), Expect = 8.9 Identities = 8/19 (42%), Positives = 14/19 (73%) Frame = -2 Query: 379 KGEPRAGTSTEGVEDQESL 323 KG+P+ GT+T ++Q+ L Sbjct: 1874 KGQPKRGTNTRKNKNQQPL 1892 >AB090823-2|BAC57922.1| 1154|Anopheles gambiae reverse transcriptase protein. Length = 1154 Score = 22.2 bits (45), Expect = 8.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 412 RSQRRDRSINKKGEPRAG 359 RS RRD IN++ P AG Sbjct: 227 RSPRRDPPINRQHTPCAG 244 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 507,441 Number of Sequences: 2352 Number of extensions: 10249 Number of successful extensions: 20 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39119412 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -