BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0790 (574 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC16C4.07 |scw1||RNA-binding protein Scw1|Schizosaccharomyces ... 28 1.1 SPBC1271.10c |||membrane transporter|Schizosaccharomyces pombe|c... 25 6.0 SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1||... 25 6.0 SPAC57A7.05 |||conserved protein |Schizosaccharomyces pombe|chr ... 25 7.9 >SPCC16C4.07 |scw1||RNA-binding protein Scw1|Schizosaccharomyces pombe|chr 3|||Manual Length = 561 Score = 27.9 bits (59), Expect = 1.1 Identities = 16/51 (31%), Positives = 28/51 (54%), Gaps = 1/51 (1%) Frame = -1 Query: 355 PNMFFNSMNINTSLVNKHG*QHKAHST-TRNAFD*KPYASLFSH*TKVETT 206 P + FNS++INT++ + K +S T+N+ P+ +FS + TT Sbjct: 319 PILRFNSLSINTNVARNYLSSEKGYSAHTQNSSAQSPHPRVFSANSAFSTT 369 >SPBC1271.10c |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 581 Score = 25.4 bits (53), Expect = 6.0 Identities = 10/27 (37%), Positives = 18/27 (66%) Frame = -3 Query: 233 FTLNESRNYIINVKNKHSYFKKIPMFT 153 +T+NE N + + +K SY+K+I + T Sbjct: 291 YTVNEISNAVQPIYSKPSYWKRIALIT 317 >SPAC4F10.16c |||P-type ATPase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1367 Score = 25.4 bits (53), Expect = 6.0 Identities = 14/52 (26%), Positives = 25/52 (48%), Gaps = 2/52 (3%) Frame = -3 Query: 320 ITSKQTRLTTQGAQHYAKRIRLKTIREFIFTL--NESRNYIINVKNKHSYFK 171 +T Q AQ + +K R+F FTL ++R Y I ++ ++ F+ Sbjct: 707 VTDVQDETLIYNAQSPDEEALVKVARDFGFTLLNTKNRRYTIRIRGENKNFR 758 >SPAC57A7.05 |||conserved protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 1337 Score = 25.0 bits (52), Expect = 7.9 Identities = 9/19 (47%), Positives = 13/19 (68%) Frame = -3 Query: 458 RPVRWLWWDIAVGNRTLVS 402 RP+R LWW + R+L+S Sbjct: 841 RPIRRLWWPLRSIRRSLLS 859 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,307,506 Number of Sequences: 5004 Number of extensions: 46120 Number of successful extensions: 120 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 119 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 120 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 244081442 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -