BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0790 (574 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) 30 1.5 SB_5192| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 SB_13057| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.2 >SB_49519| Best HMM Match : DUF1378 (HMM E-Value=8.8) Length = 213 Score = 29.9 bits (64), Expect = 1.5 Identities = 13/33 (39%), Positives = 21/33 (63%) Frame = -3 Query: 104 LNDSR*QSNVRFSKETLKNLTDYNFGDATRATR 6 LND +S RF K+T++ +T + G+ +R TR Sbjct: 31 LNDQEVKSRFRFRKDTIEYITQFLRGELSRDTR 63 >SB_5192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4865 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = +3 Query: 483 PEDKTQVLATTPRVDVETNPKTLTH 557 P+ KT+ + TTP V TN + ++H Sbjct: 1635 PQRKTESIDTTPEVPTTTNAREISH 1659 >SB_13057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 892 Score = 27.5 bits (58), Expect = 8.2 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = -1 Query: 184 IPILKKFQCLPTNCFCGYDVTTSIFE 107 +P+ K+ Q P N FC Y T F+ Sbjct: 786 LPVKKRHQFCPVNSFCAYKNLTKTFK 811 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,571,203 Number of Sequences: 59808 Number of extensions: 334014 Number of successful extensions: 1403 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1384 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1403 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1361520496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -