BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0786 (454 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex det... 26 0.22 DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex det... 26 0.22 DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex det... 26 0.22 DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex det... 26 0.22 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 26 0.22 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 26 0.22 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 26 0.22 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 26 0.22 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 26 0.22 DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein ... 24 0.67 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 24 0.67 AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein ... 24 0.67 DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex det... 24 0.89 DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex det... 24 0.89 DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex det... 24 0.89 DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex det... 24 0.89 DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex det... 24 0.89 DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex det... 24 0.89 DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex det... 22 2.7 DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex det... 22 2.7 DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex det... 22 2.7 DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex det... 22 2.7 DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex det... 22 2.7 DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex det... 22 2.7 DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex det... 22 2.7 DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex det... 22 2.7 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 4.7 DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride c... 21 6.3 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 6.3 AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl sub... 21 6.3 DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex det... 21 8.3 DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex det... 21 8.3 DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex det... 21 8.3 DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase ... 21 8.3 DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase ... 21 8.3 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 8.3 AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor pr... 21 8.3 >DQ325094-1|ABD14108.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 25.8 bits (54), Expect = 0.22 Identities = 13/55 (23%), Positives = 26/55 (47%) Frame = -2 Query: 420 VYRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQHLSNLQVLFF 256 +Y+ +R KY + +R + SKE S YN++ + +N + L++ Sbjct: 49 LYKNEREYRKYGETSKERSRNRTEREKSKEPKIISSLSNNYNYNNYNNNYKPLYY 103 >DQ325093-1|ABD14107.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 25.8 bits (54), Expect = 0.22 Identities = 13/55 (23%), Positives = 26/55 (47%) Frame = -2 Query: 420 VYRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQHLSNLQVLFF 256 +Y+ +R KY + +R + SKE S YN++ + +N + L++ Sbjct: 49 LYKNEREYRKYGETSKERSRNRTEREKSKEPKIISSLSNNYNYNNYNNNYKPLYY 103 >DQ325092-1|ABD14106.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 25.8 bits (54), Expect = 0.22 Identities = 13/55 (23%), Positives = 26/55 (47%) Frame = -2 Query: 420 VYRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQHLSNLQVLFF 256 +Y+ +R KY + +R + SKE S YN++ + +N + L++ Sbjct: 49 LYKNEREYRKYGETSKERSRNRTEREKSKEPKIISSLSNNYNYNNYNNNYKPLYY 103 >DQ325091-1|ABD14105.1| 175|Apis mellifera complementary sex determiner protein. Length = 175 Score = 25.8 bits (54), Expect = 0.22 Identities = 13/55 (23%), Positives = 26/55 (47%) Frame = -2 Query: 420 VYRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQHLSNLQVLFF 256 +Y+ +R KY + +R + SKE S YN++ + +N + L++ Sbjct: 49 LYKNEREYRKYGETSKERSRNRTEREKSKEPKIISSLSNNYNYNNYNNNYKPLYY 103 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 25.8 bits (54), Expect = 0.22 Identities = 13/55 (23%), Positives = 26/55 (47%) Frame = -2 Query: 420 VYRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQHLSNLQVLFF 256 +Y+ +R KY + +R + SKE S YN++ + +N + L++ Sbjct: 282 LYKNEREYRKYGETSKERSRNRTEREKSKEPKIISSLSNNYNYNNYNNNYKPLYY 336 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.8 bits (54), Expect = 0.22 Identities = 13/55 (23%), Positives = 26/55 (47%) Frame = -2 Query: 420 VYRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQHLSNLQVLFF 256 +Y+ +R KY + +R + SKE S YN++ + +N + L++ Sbjct: 282 LYKNEREYRKYGETSKERSRNRTEREKSKEPKIISSLSNNYNYNNYNNNYKPLYY 336 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.8 bits (54), Expect = 0.22 Identities = 13/55 (23%), Positives = 26/55 (47%) Frame = -2 Query: 420 VYRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQHLSNLQVLFF 256 +Y+ +R KY + +R + SKE S YN++ + +N + L++ Sbjct: 282 LYKNEREYRKYGETSKERSRNRTEREKSKEPKIISSLSNNYNYNNYNNNYKPLYY 336 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.8 bits (54), Expect = 0.22 Identities = 13/55 (23%), Positives = 26/55 (47%) Frame = -2 Query: 420 VYRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQHLSNLQVLFF 256 +Y+ +R KY + +R + SKE S YN++ + +N + L++ Sbjct: 282 LYKNEREYRKYGETSKERSRNRTEREKSKEPKIISSLSNNYNYNNYNNNYKPLYY 336 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 25.8 bits (54), Expect = 0.22 Identities = 13/55 (23%), Positives = 26/55 (47%) Frame = -2 Query: 420 VYRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQHLSNLQVLFF 256 +Y+ +R KY + +R + SKE S YN++ + +N + L++ Sbjct: 271 LYKNEREYRKYGETSKERSRNRTEREKSKEPKIISSLSNNYNYNNYNNNYKPLYY 325 >DQ855487-1|ABH88174.1| 125|Apis mellifera chemosensory protein 6 protein. Length = 125 Score = 24.2 bits (50), Expect = 0.67 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +1 Query: 4 PCSYSGRVPLVRLLAC*WSPMAATS*RDTQRKMKACNK--NYARTRTPAEWFRLVA 165 PC+ GR L ++L ++ + +++ NK NY +T+ P +W RL A Sbjct: 52 PCTNEGR-ELKKILP---DALSTGCNKCNEKQKHTANKVVNYLKTKRPKDWERLSA 103 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 24.2 bits (50), Expect = 0.67 Identities = 13/55 (23%), Positives = 25/55 (45%) Frame = -2 Query: 420 VYRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQHLSNLQVLFF 256 +Y+ +R KY + +R + SKE S YN++ + +N + L + Sbjct: 282 LYKNEREYRKYGETSKERSRNRTEREKSKEPKIISSLSNNYNYNNYNNNYKPLHY 336 >AJ973402-1|CAJ01449.1| 125|Apis mellifera hypothetical protein protein. Length = 125 Score = 24.2 bits (50), Expect = 0.67 Identities = 16/56 (28%), Positives = 28/56 (50%), Gaps = 2/56 (3%) Frame = +1 Query: 4 PCSYSGRVPLVRLLAC*WSPMAATS*RDTQRKMKACNK--NYARTRTPAEWFRLVA 165 PC+ GR L ++L ++ + +++ NK NY +T+ P +W RL A Sbjct: 52 PCTNEGR-ELKKILP---DALSTGCNKCNEKQKHTANKVVNYLKTKRPKDWERLSA 103 >DQ325130-1|ABD14144.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.8 bits (49), Expect = 0.89 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = -2 Query: 417 YRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQHLSN 274 Y+ + KY + + DR + SKE S YN+S + +N Sbjct: 50 YKNENSYRKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNN 97 >DQ325129-1|ABD14143.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.8 bits (49), Expect = 0.89 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = -2 Query: 417 YRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQHLSN 274 Y+ + KY + + DR + SKE S YN+S + +N Sbjct: 50 YKNENSYRKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNN 97 >DQ325128-1|ABD14142.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.8 bits (49), Expect = 0.89 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = -2 Query: 417 YRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQHLSN 274 Y+ + KY + + DR + SKE S YN+S + +N Sbjct: 50 YKNENSYRKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNN 97 >DQ325127-1|ABD14141.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.8 bits (49), Expect = 0.89 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = -2 Query: 417 YRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQHLSN 274 Y+ + KY + + DR + SKE S YN+S + +N Sbjct: 50 YKNENSYRKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNN 97 >DQ325126-1|ABD14140.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.8 bits (49), Expect = 0.89 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = -2 Query: 417 YRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQHLSN 274 Y+ + KY + + DR + SKE S YN+S + +N Sbjct: 50 YKNENSYRKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNN 97 >DQ325125-1|ABD14139.1| 174|Apis mellifera complementary sex determiner protein. Length = 174 Score = 23.8 bits (49), Expect = 0.89 Identities = 13/48 (27%), Positives = 21/48 (43%) Frame = -2 Query: 417 YRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQHLSN 274 Y+ + KY + + DR + SKE S YN+S + +N Sbjct: 50 YKNENSYRKYRKTSKERSRDRTERERSKEPKIISSLSNNYNYSNYNNN 97 >DQ325102-1|ABD14116.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 2.7 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = -2 Query: 417 YRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQH 283 Y+ +R KY + DR + SKE S YN+S + Sbjct: 50 YKNEREYRKYRETSKERSRDRRERERSKEPKIVSSLSNNYNYSNY 94 >DQ325101-1|ABD14115.1| 182|Apis mellifera complementary sex determiner protein. Length = 182 Score = 22.2 bits (45), Expect = 2.7 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = -2 Query: 417 YRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQH 283 Y+ +R KY + DR + SKE S YN+S + Sbjct: 50 YKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNNYNYSNY 94 >DQ325100-1|ABD14114.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 2.7 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = -2 Query: 417 YRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQH 283 Y+ +R KY + DR + SKE S YN+S + Sbjct: 50 YKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNNYNYSNY 94 >DQ325099-1|ABD14113.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 2.7 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = -2 Query: 417 YRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQH 283 Y+ +R KY + DR + SKE S YN+S + Sbjct: 50 YKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNNYNYSNY 94 >DQ325098-1|ABD14112.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 2.7 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = -2 Query: 417 YRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQH 283 Y+ +R KY + DR + SKE S YN+S + Sbjct: 50 YKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNNYNYSNY 94 >DQ325097-1|ABD14111.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 2.7 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = -2 Query: 417 YRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQH 283 Y+ +R KY + DR + SKE S YN+S + Sbjct: 50 YKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNNYNYSNY 94 >DQ325096-1|ABD14110.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 2.7 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = -2 Query: 417 YRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQH 283 Y+ +R KY + DR + SKE S YN+S + Sbjct: 50 YKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNNYNYSNY 94 >DQ325095-1|ABD14109.1| 183|Apis mellifera complementary sex determiner protein. Length = 183 Score = 22.2 bits (45), Expect = 2.7 Identities = 13/45 (28%), Positives = 19/45 (42%) Frame = -2 Query: 417 YRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQH 283 Y+ +R KY + DR + SKE S YN+S + Sbjct: 50 YKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNNYNYSNY 94 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.4 bits (43), Expect = 4.7 Identities = 12/45 (26%), Positives = 18/45 (40%) Frame = -2 Query: 417 YRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQH 283 Y+ +R KY + DR + SKE S Y +S + Sbjct: 283 YKNEREYRKYGETSKERSRDRTERERSKEPKIISSLSNNYKYSNY 327 >DQ667182-1|ABG75734.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.0 bits (42), Expect = 6.3 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -3 Query: 290 RSIFPICRSCFS 255 R +FP+C CF+ Sbjct: 409 RIVFPVCFVCFN 420 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.0 bits (42), Expect = 6.3 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -3 Query: 290 RSIFPICRSCFS 255 R +FP+C CF+ Sbjct: 409 RIVFPVCFVCFN 420 >AF094822-1|AAC63381.1| 365|Apis mellifera GABA receptor Rdl subunit protein. Length = 365 Score = 21.0 bits (42), Expect = 6.3 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = -3 Query: 290 RSIFPICRSCFS 255 R +FP+C CF+ Sbjct: 347 RIVFPVCFVCFN 358 >DQ325124-1|ABD14138.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 8.3 Identities = 12/45 (26%), Positives = 19/45 (42%) Frame = -2 Query: 417 YRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQH 283 Y+ +R KY + DR + SKE S YN++ + Sbjct: 50 YKNEREYRKYRETSKERSRDRKEREKSKEHKIISSLSNNYNYNNN 94 >DQ325123-1|ABD14137.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 8.3 Identities = 12/45 (26%), Positives = 19/45 (42%) Frame = -2 Query: 417 YRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQH 283 Y+ +R KY + DR + SKE S YN++ + Sbjct: 50 YKNEREYRKYRETSKERSRDRKEREKSKEHKIISSLSNNYNYNNN 94 >DQ325122-1|ABD14136.1| 179|Apis mellifera complementary sex determiner protein. Length = 179 Score = 20.6 bits (41), Expect = 8.3 Identities = 12/45 (26%), Positives = 19/45 (42%) Frame = -2 Query: 417 YRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQH 283 Y+ +R KY + DR + SKE S YN++ + Sbjct: 50 YKNEREYRKYRETSKERSRDRKEREKSKEHKIISSLSNNYNYNNN 94 >DQ013068-1|AAY81956.1| 931|Apis mellifera dusty protein kinase isoform B protein. Length = 931 Score = 20.6 bits (41), Expect = 8.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +3 Query: 429 GLWRWI 446 GLWRWI Sbjct: 57 GLWRWI 62 >DQ013067-1|AAY81955.1| 969|Apis mellifera dusty protein kinase isoform A protein. Length = 969 Score = 20.6 bits (41), Expect = 8.3 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +3 Query: 429 GLWRWI 446 GLWRWI Sbjct: 95 GLWRWI 100 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 20.6 bits (41), Expect = 8.3 Identities = 13/48 (27%), Positives = 20/48 (41%) Frame = -2 Query: 417 YRKDRVKCKYSRRKQVSHLDRVVLQCSKEALFYGHCS*AYNFSQHLSN 274 Y+ +R KY + DR + SKE S + N+S + N Sbjct: 272 YKNEREYRKYRETSKERSRDRRERERSKEPKIISSLSNSCNYSNNYYN 319 >AM076717-1|CAJ28210.1| 501|Apis mellifera serotonin receptor protein. Length = 501 Score = 20.6 bits (41), Expect = 8.3 Identities = 8/27 (29%), Positives = 12/27 (44%) Frame = +2 Query: 209 WGIQTIRCPAGLVFDMKNKTCRLERCC 289 W TI C + FD+ + T + C Sbjct: 107 WSFGTIMCDLWVSFDVLSCTASILNLC 133 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 134,857 Number of Sequences: 438 Number of extensions: 3008 Number of successful extensions: 39 Number of sequences better than 10.0: 37 Number of HSP's better than 10.0 without gapping: 39 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 39 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11943513 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -