BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0776 (578 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 25 0.35 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 23 2.5 AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nu... 22 4.3 AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esteras... 22 4.3 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 4.3 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 25.4 bits (53), Expect = 0.35 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = -2 Query: 382 STPYGSVDRSSPPSLPSNKCGSRNKS--TTSLAPPLYTGSASKR 257 S Y S++ ++PP P + S ++ T S PPLY +KR Sbjct: 720 SISYLSMENNAPPPPPPPRVESFAETVRTVSKIPPLYKDLVAKR 763 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 22.6 bits (46), Expect = 2.5 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +3 Query: 360 STDPYGVLPLWRSNDLN 410 + DPYG++ W ++ LN Sbjct: 141 AVDPYGLVAQWATDALN 157 >AM295014-1|CAL25729.1| 407|Tribolium castaneum ultraspiracle nuclear receptor protein. Length = 407 Score = 21.8 bits (44), Expect = 4.3 Identities = 13/28 (46%), Positives = 16/28 (57%) Frame = -2 Query: 343 SLPSNKCGSRNKSTTSLAPPLYTGSASK 260 SL S + NKS+TS PP + S SK Sbjct: 56 SLLSPSGNTPNKSSTSPYPPNHPLSGSK 83 >AJ845188-1|CAH60165.1| 517|Tribolium castaneum putative esterase protein. Length = 517 Score = 21.8 bits (44), Expect = 4.3 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = -2 Query: 502 TVLSGGYHHVPL 467 T+ SG Y+HVP+ Sbjct: 292 TIKSGDYNHVPM 303 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 21.8 bits (44), Expect = 4.3 Identities = 8/25 (32%), Positives = 15/25 (60%) Frame = -2 Query: 340 LPSNKCGSRNKSTTSLAPPLYTGSA 266 LP+++C SR S + + P +G + Sbjct: 79 LPNSRCNSRESSDSLVQPRCPSGES 103 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 141,359 Number of Sequences: 336 Number of extensions: 3119 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 14412858 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -