BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0776 (578 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U02964-1|AAA03444.1| 376|Anopheles gambiae actin 1D protein. 148 1e-37 U02933-1|AAA56882.1| 376|Anopheles gambiae actin 1D protein. 148 1e-37 U02930-1|AAA56881.1| 376|Anopheles gambiae actin 1D protein. 148 1e-37 CR954256-1|CAJ14142.1| 376|Anopheles gambiae actin protein. 138 2e-34 AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein... 24 4.1 AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phospho... 23 9.5 AF203338-1|AAF19833.1| 113|Anopheles gambiae immune-responsive ... 23 9.5 >U02964-1|AAA03444.1| 376|Anopheles gambiae actin 1D protein. Length = 376 Score = 148 bits (359), Expect = 1e-37 Identities = 69/69 (100%), Positives = 69/69 (100%) Frame = -1 Query: 470 PGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 291 PGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG Sbjct: 308 PGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 367 Query: 290 PSIVHRKCF 264 PSIVHRKCF Sbjct: 368 PSIVHRKCF 376 Score = 62.5 bits (145), Expect = 1e-11 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = -3 Query: 576 CGIHETTYNSIMKCDVDIRKDL*PTPYCPVGTTMYP 469 CGIHETTYNSIMKCDVDIRKDL GTTMYP Sbjct: 273 CGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYP 308 >U02933-1|AAA56882.1| 376|Anopheles gambiae actin 1D protein. Length = 376 Score = 148 bits (359), Expect = 1e-37 Identities = 69/69 (100%), Positives = 69/69 (100%) Frame = -1 Query: 470 PGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 291 PGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG Sbjct: 308 PGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 367 Query: 290 PSIVHRKCF 264 PSIVHRKCF Sbjct: 368 PSIVHRKCF 376 Score = 62.5 bits (145), Expect = 1e-11 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = -3 Query: 576 CGIHETTYNSIMKCDVDIRKDL*PTPYCPVGTTMYP 469 CGIHETTYNSIMKCDVDIRKDL GTTMYP Sbjct: 273 CGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYP 308 >U02930-1|AAA56881.1| 376|Anopheles gambiae actin 1D protein. Length = 376 Score = 148 bits (359), Expect = 1e-37 Identities = 69/69 (100%), Positives = 69/69 (100%) Frame = -1 Query: 470 PGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 291 PGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG Sbjct: 308 PGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 367 Query: 290 PSIVHRKCF 264 PSIVHRKCF Sbjct: 368 PSIVHRKCF 376 Score = 62.5 bits (145), Expect = 1e-11 Identities = 28/36 (77%), Positives = 28/36 (77%) Frame = -3 Query: 576 CGIHETTYNSIMKCDVDIRKDL*PTPYCPVGTTMYP 469 CGIHETTYNSIMKCDVDIRKDL GTTMYP Sbjct: 273 CGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYP 308 >CR954256-1|CAJ14142.1| 376|Anopheles gambiae actin protein. Length = 376 Score = 138 bits (333), Expect = 2e-34 Identities = 63/69 (91%), Positives = 65/69 (94%) Frame = -1 Query: 470 PGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESG 291 PGIADRMQKEIT+LAPST+KIKIIAPPERKYSVWIGGSILASLSTFQ MWISK EYDE G Sbjct: 308 PGIADRMQKEITSLAPSTIKIKIIAPPERKYSVWIGGSILASLSTFQTMWISKHEYDEGG 367 Query: 290 PSIVHRKCF 264 P IVHRKCF Sbjct: 368 PGIVHRKCF 376 Score = 55.6 bits (128), Expect = 1e-09 Identities = 25/35 (71%), Positives = 26/35 (74%) Frame = -3 Query: 573 GIHETTYNSIMKCDVDIRKDL*PTPYCPVGTTMYP 469 GIHET YNSIM+CDVDIRKDL GTTMYP Sbjct: 274 GIHETVYNSIMRCDVDIRKDLYANSVLSGGTTMYP 308 >AJ439353-5|CAD27927.1| 459|Anopheles gambiae putative G-protein coupled receptor protein. Length = 459 Score = 23.8 bits (49), Expect = 4.1 Identities = 12/36 (33%), Positives = 15/36 (41%) Frame = +1 Query: 223 PAAGCWRQRRACV*KHFLCTMEGPDSSYSCFEIHIC 330 P+ CW R + LCT P + C I IC Sbjct: 234 PSCSCWVVRIPIGKTYSLCTNSFPLGTLLCVGIVIC 269 >AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phosphoribosyltransferase-like protein protein. Length = 519 Score = 22.6 bits (46), Expect = 9.5 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -1 Query: 260 THARRCLQQPAAGC 219 TH C +QPA GC Sbjct: 355 THLVTCQRQPALGC 368 >AF203338-1|AAF19833.1| 113|Anopheles gambiae immune-responsive trypsin-like serineprotease-related protein ISPR10 protein. Length = 113 Score = 22.6 bits (46), Expect = 9.5 Identities = 12/21 (57%), Positives = 13/21 (61%), Gaps = 2/21 (9%) Frame = -2 Query: 337 PSNKCGSRNKSTT--SLAPPL 281 P NK GSRN+ T LA PL Sbjct: 80 PGNKKGSRNRDTALLLLAEPL 100 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 631,385 Number of Sequences: 2352 Number of extensions: 13466 Number of successful extensions: 37 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 55086417 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -