BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0775 (321 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_02_0298 - 7061908-7061913,7061952-7062032,7062363-7062564,706... 26 7.6 05_04_0203 + 19016547-19016860,19017020-19017169,19017946-190180... 26 7.6 >09_02_0298 - 7061908-7061913,7061952-7062032,7062363-7062564, 7062665-7062890,7063030-7063143,7063213-7063270 Length = 228 Score = 25.8 bits (54), Expect = 7.6 Identities = 13/33 (39%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +2 Query: 170 LCPDDEVNIKNSYCLNGWTS-SQPTWCQMVLEP 265 L +D N KN+ CL GW + W Q+V P Sbjct: 175 LATEDAENFKNTECL-GWRHYVKSDWTQLVASP 206 >05_04_0203 + 19016547-19016860,19017020-19017169,19017946-19018081, 19018222-19018323,19018556-19018675,19018800-19018880, 19019041-19019381,19020296-19020589,19020701-19021025, 19021167-19021400,19021506-19021760 Length = 783 Score = 25.8 bits (54), Expect = 7.6 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = -2 Query: 284 TLWYVLWAPVPFDTRW 237 TLW WAP P D W Sbjct: 343 TLWLTEWAPEPRDVFW 358 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,088,025 Number of Sequences: 37544 Number of extensions: 138088 Number of successful extensions: 272 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 272 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 272 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 411066120 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -