BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0774 (634 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11257| Best HMM Match : GCC2_GCC3 (HMM E-Value=2.7e-11) 30 1.4 SB_12604| Best HMM Match : PsbH (HMM E-Value=5.9) 29 2.4 SB_3223| Best HMM Match : Ion_trans (HMM E-Value=0) 29 4.1 SB_24190| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.2 >SB_11257| Best HMM Match : GCC2_GCC3 (HMM E-Value=2.7e-11) Length = 3810 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -1 Query: 634 QQVCCSALLPTHY*KNTYGPIIRYIPLNTI*NHH 533 +Q C P Y +TYGP++ Y P I H+ Sbjct: 2249 RQWTCKKCPPGFYCNDTYGPVVDYAPFECIEGHY 2282 >SB_12604| Best HMM Match : PsbH (HMM E-Value=5.9) Length = 105 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/30 (40%), Positives = 20/30 (66%) Frame = +3 Query: 312 DDHTARLMVSGYRRPWTSAMPGSEPGRCLK 401 +++T + +GY ++S PG EPG+CLK Sbjct: 13 NNNTEYRLQAGYGLRFSSKRPGYEPGQCLK 42 >SB_3223| Best HMM Match : Ion_trans (HMM E-Value=0) Length = 486 Score = 28.7 bits (61), Expect = 4.1 Identities = 12/36 (33%), Positives = 18/36 (50%) Frame = -2 Query: 351 DGNHSPSGGPYDRLPTRVIIIKKVNFYAIENVKTRT 244 DG H GP+ P+ ++ N Y++E VK T Sbjct: 449 DGEHELVNGPFVASPSGHLVTSAHNSYSLEEVKVET 484 >SB_24190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 27.9 bits (59), Expect = 7.2 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = +3 Query: 378 SEPGRCLKNCLITQNC 425 ++P C KNC +T NC Sbjct: 17 TDPSECKKNCFLTDNC 32 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,143,309 Number of Sequences: 59808 Number of extensions: 316414 Number of successful extensions: 762 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 698 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 762 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1584657875 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -