BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0774 (634 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. 26 1.1 AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homoc... 24 3.5 >AY534995-1|AAT07393.1| 461|Anopheles gambiae XK-related protein. Length = 461 Score = 25.8 bits (54), Expect = 1.1 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +1 Query: 439 EGTLPIRLVFFACLCFILTV 498 EGT +R FF +CF+ TV Sbjct: 376 EGTTRLRYTFFYAVCFVETV 395 >AF080546-1|AAC29475.1| 432|Anopheles gambiae S-adenosyl-L-homocysteine hydrolase protein. Length = 432 Score = 24.2 bits (50), Expect = 3.5 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = +1 Query: 217 RVFHEVTVLSASFNVFDSVKVNFFYYYYSCRQTII 321 ++F E + + NV DSV + F Y CR++++ Sbjct: 166 KMFREGRLGMPAINVNDSVTKSKFDNLYGCRESLL 200 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 602,461 Number of Sequences: 2352 Number of extensions: 12942 Number of successful extensions: 25 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 23 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 61886940 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -