BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0773 (381 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 24 0.59 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 4.2 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 4.2 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 4.2 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 4.2 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 4.2 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 4.2 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 4.2 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 4.2 DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 pro... 21 5.5 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 23.8 bits (49), Expect = 0.59 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = +1 Query: 304 PVCPGSCRSPTISNSSPSNYS 366 P C + SPT S+SS S++S Sbjct: 194 PTCSEASSSPTPSHSSESSFS 214 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 4.2 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -3 Query: 379 RSTPANSCSANYSILLDSGSFPDRPVSTMSSSTPA 275 RSTP S +N + SG VST PA Sbjct: 124 RSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPA 158 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 4.2 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -3 Query: 379 RSTPANSCSANYSILLDSGSFPDRPVSTMSSSTPA 275 RSTP S +N + SG VST PA Sbjct: 124 RSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPA 158 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.0 bits (42), Expect = 4.2 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -3 Query: 379 RSTPANSCSANYSILLDSGSFPDRPVSTMSSSTPA 275 RSTP S +N + SG VST PA Sbjct: 124 RSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPA 158 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 4.2 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -3 Query: 379 RSTPANSCSANYSILLDSGSFPDRPVSTMSSSTPA 275 RSTP S +N + SG VST PA Sbjct: 124 RSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPA 158 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.0 bits (42), Expect = 4.2 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -3 Query: 379 RSTPANSCSANYSILLDSGSFPDRPVSTMSSSTPA 275 RSTP S +N + SG VST PA Sbjct: 124 RSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPA 158 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.0 bits (42), Expect = 4.2 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -3 Query: 379 RSTPANSCSANYSILLDSGSFPDRPVSTMSSSTPA 275 RSTP S +N + SG VST PA Sbjct: 80 RSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPA 114 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 4.2 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -3 Query: 379 RSTPANSCSANYSILLDSGSFPDRPVSTMSSSTPA 275 RSTP S +N + SG VST PA Sbjct: 124 RSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPA 158 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 4.2 Identities = 13/35 (37%), Positives = 15/35 (42%) Frame = -3 Query: 379 RSTPANSCSANYSILLDSGSFPDRPVSTMSSSTPA 275 RSTP S +N + SG VST PA Sbjct: 124 RSTPPLSTPSNSNATKSSGLTSPLSVSTSPPGKPA 158 >DQ659251-1|ABG47449.1| 366|Tribolium castaneum chitinase 11 protein. Length = 366 Score = 20.6 bits (41), Expect = 5.5 Identities = 9/34 (26%), Positives = 14/34 (41%) Frame = +1 Query: 148 YRRSLG*FGARRIGSKLLGFAHRCLINCKSEGNM 249 YR G F + I + L H + S+G + Sbjct: 36 YRNGEGSFKPQNINANLCTHVHYAFLGVNSDGTL 69 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 86,043 Number of Sequences: 336 Number of extensions: 1795 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 51 effective length of database: 105,449 effective search space used: 7908675 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 39 (20.8 bits)
- SilkBase 1999-2023 -