BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0773 (381 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AE014134-551|AAF51149.1| 2409|Drosophila melanogaster CG3524-PA ... 50 1e-06 AE014134-552|AAF51148.1| 2438|Drosophila melanogaster CG3523-PA ... 44 9e-05 >AE014134-551|AAF51149.1| 2409|Drosophila melanogaster CG3524-PA protein. Length = 2409 Score = 50.0 bits (114), Expect = 1e-06 Identities = 23/39 (58%), Positives = 29/39 (74%) Frame = +3 Query: 264 GTNGAGVDDDIVLTGLSGKLPESNNIE*FAEQLFAGVDL 380 G + AG D DIV++GLSGKLPES+NIE F L G+D+ Sbjct: 9 GESAAGEDADIVISGLSGKLPESSNIEEFKYNLLNGIDM 47 >AE014134-552|AAF51148.1| 2438|Drosophila melanogaster CG3523-PA protein. Length = 2438 Score = 43.6 bits (98), Expect = 9e-05 Identities = 18/33 (54%), Positives = 26/33 (78%) Frame = +3 Query: 282 VDDDIVLTGLSGKLPESNNIE*FAEQLFAGVDL 380 ++D+I +TG SG+LPES+ IE F + LF GVD+ Sbjct: 36 LNDEIAITGFSGRLPESSTIEEFKQNLFDGVDM 68 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,034,728 Number of Sequences: 53049 Number of extensions: 340839 Number of successful extensions: 1006 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 960 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1006 length of database: 24,988,368 effective HSP length: 77 effective length of database: 20,903,595 effective search space used: 1024276155 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -