BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0772 (545 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46749| Best HMM Match : No HMM Matches (HMM E-Value=.) 113 9e-26 SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 53 1e-07 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 52 3e-07 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 9e-07 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 9e-07 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 50 9e-07 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 9e-07 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 50 9e-07 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 50 9e-07 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 50 9e-07 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 48 5e-06 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 48 5e-06 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 47 1e-05 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 44 6e-05 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 6e-05 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 2e-04 SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 41 8e-04 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.002 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 39 0.002 SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.009 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.012 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.016 SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 36 0.029 SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.029 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.066 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.066 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.066 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.066 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.066 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.066 SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) 32 0.27 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.1 SB_6110| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_4878| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) 29 2.5 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.3 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 28 5.7 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 28 5.7 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 28 5.7 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 28 5.7 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 28 5.7 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 28 5.7 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 28 5.7 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 28 5.7 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 28 5.7 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 28 5.7 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 28 5.7 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 28 5.7 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 28 5.7 SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) 28 5.7 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 28 5.7 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 28 5.7 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 28 5.7 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 28 5.7 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 28 5.7 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 28 5.7 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 28 5.7 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 28 5.7 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 28 5.7 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 28 5.7 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 28 5.7 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 28 5.7 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 28 5.7 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 28 5.7 SB_46303| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_45813| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_45524| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_45424| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_45381| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 28 5.7 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 28 5.7 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_44401| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 28 5.7 SB_44076| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 28 5.7 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_43701| Best HMM Match : ubiquitin (HMM E-Value=0.003) 28 5.7 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 28 5.7 SB_43138| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.3e-14) 28 5.7 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_42990| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 28 5.7 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 28 5.7 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_42313| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_41881| Best HMM Match : Extensin_1 (HMM E-Value=5.5) 28 5.7 SB_41827| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_40265| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_40240| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_39438| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 28 5.7 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 28 5.7 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 28 5.7 SB_38726| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_38387| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 28 5.7 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 28 5.7 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 28 5.7 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_37038| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 28 5.7 SB_36823| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 28 5.7 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_35768| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_35698| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_35611| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_35484| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_35280| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 28 5.7 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_35129| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 28 5.7 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 28 5.7 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_34190| Best HMM Match : MAM (HMM E-Value=0) 28 5.7 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 28 5.7 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_33625| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_33491| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_32529| Best HMM Match : Laminin_G_2 (HMM E-Value=0) 28 5.7 SB_32525| Best HMM Match : DED (HMM E-Value=0.81) 28 5.7 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_32317| Best HMM Match : Cadherin (HMM E-Value=1.5e-28) 28 5.7 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 28 5.7 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_31776| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_31757| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 28 5.7 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 28 5.7 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_31450| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_31401| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 28 5.7 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 28 5.7 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 28 5.7 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_30849| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 28 5.7 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 28 5.7 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_30113| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_29660| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_29646| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_29397| Best HMM Match : fn3 (HMM E-Value=0.038) 28 5.7 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_29340| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 28 5.7 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_29178| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_29126| Best HMM Match : FUN14 (HMM E-Value=1.8) 28 5.7 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_29000| Best HMM Match : DUF551 (HMM E-Value=2.2) 28 5.7 SB_28961| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 28 5.7 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 28 5.7 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 28 5.7 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.7 >SB_46749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 113 bits (272), Expect = 9e-26 Identities = 55/61 (90%), Positives = 58/61 (95%) Frame = -3 Query: 438 LEEKDPKRLFEGNALLRRLVRIGVLDEKQMKLDYVLGLKIEDFLERRLQTQVFKAGLAKS 259 LEEKDP+RLFEGNALLRRLVRIGVLDE + KLDYVLGL+IEDFLERRLQTQVFK GLAKS Sbjct: 60 LEEKDPRRLFEGNALLRRLVRIGVLDESRKKLDYVLGLRIEDFLERRLQTQVFKLGLAKS 119 Query: 258 I 256 I Sbjct: 120 I 120 Score = 113 bits (271), Expect = 1e-25 Identities = 49/58 (84%), Positives = 56/58 (96%) Frame = -2 Query: 253 HARILIRQRHIRVRKQVVNIPSFIVRLDSGKHIDFSLKSPFGGGRPGRVKRKNLRKGQ 80 HAR+LIRQRHIRVRKQ+VN+PSF+VRLDS KHIDFSL SP+GGGRPGRVKRKN++KGQ Sbjct: 122 HARVLIRQRHIRVRKQLVNVPSFVVRLDSQKHIDFSLNSPYGGGRPGRVKRKNMKKGQ 179 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 62.9 bits (146), Expect = 2e-10 Identities = 25/29 (86%), Positives = 25/29 (86%) Frame = -1 Query: 539 SWVTPGFSQSHVVKRRPVNCNTTHYRANW 453 SWVTPGF VVKRRPVNCNTTHYRANW Sbjct: 52 SWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 53.2 bits (122), Expect = 1e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = -1 Query: 533 VTPGFSQSHVVKRRPVNCNTTHYRANW 453 VTP F VVKRRPVNCNTTHYRANW Sbjct: 1873 VTPVFPSHDVVKRRPVNCNTTHYRANW 1899 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 52.0 bits (119), Expect = 3e-07 Identities = 25/36 (69%), Positives = 26/36 (72%) Frame = +3 Query: 438 GGARYPIRPIVSRITIHWPSFYNV*LGKPWRYPTLN 545 GGA PIRPIVSRITIHWP+FYN GK Y LN Sbjct: 36 GGA--PIRPIVSRITIHWPAFYNAPTGKTLAYTQLN 69 >SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 408 Score = 50.4 bits (115), Expect = 9e-07 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -1 Query: 524 GFSQSHVVKRRPVNCNTTHYRANW 453 GF VVKRRPVNCNTTHYRANW Sbjct: 1 GFPSHDVVKRRPVNCNTTHYRANW 24 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 50.4 bits (115), Expect = 9e-07 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -1 Query: 524 GFSQSHVVKRRPVNCNTTHYRANW 453 GF VVKRRPVNCNTTHYRANW Sbjct: 57 GFPSHDVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 50.4 bits (115), Expect = 9e-07 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -1 Query: 524 GFSQSHVVKRRPVNCNTTHYRANW 453 GF VVKRRPVNCNTTHYRANW Sbjct: 625 GFPSHDVVKRRPVNCNTTHYRANW 648 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 50.4 bits (115), Expect = 9e-07 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -1 Query: 524 GFSQSHVVKRRPVNCNTTHYRANW 453 GF VVKRRPVNCNTTHYRANW Sbjct: 36 GFPSHDVVKRRPVNCNTTHYRANW 59 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 50.4 bits (115), Expect = 9e-07 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -1 Query: 524 GFSQSHVVKRRPVNCNTTHYRANW 453 GF VVKRRPVNCNTTHYRANW Sbjct: 79 GFPSHDVVKRRPVNCNTTHYRANW 102 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 50.4 bits (115), Expect = 9e-07 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -1 Query: 524 GFSQSHVVKRRPVNCNTTHYRANW 453 GF VVKRRPVNCNTTHYRANW Sbjct: 68 GFPSHDVVKRRPVNCNTTHYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 50.4 bits (115), Expect = 9e-07 Identities = 20/24 (83%), Positives = 20/24 (83%) Frame = -1 Query: 524 GFSQSHVVKRRPVNCNTTHYRANW 453 GF VVKRRPVNCNTTHYRANW Sbjct: 68 GFPSHDVVKRRPVNCNTTHYRANW 91 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 48.0 bits (109), Expect = 5e-06 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 521 FSQSHVVKRRPVNCNTTHYRANW 453 F VVKRRPVNCNTTHYRANW Sbjct: 39 FPSHDVVKRRPVNCNTTHYRANW 61 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 48.0 bits (109), Expect = 5e-06 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 521 FSQSHVVKRRPVNCNTTHYRANW 453 F VVKRRPVNCNTTHYRANW Sbjct: 37 FPSHDVVKRRPVNCNTTHYRANW 59 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 48.0 bits (109), Expect = 5e-06 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 521 FSQSHVVKRRPVNCNTTHYRANW 453 F VVKRRPVNCNTTHYRANW Sbjct: 31 FPSHDVVKRRPVNCNTTHYRANW 53 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 48.0 bits (109), Expect = 5e-06 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 521 FSQSHVVKRRPVNCNTTHYRANW 453 F VVKRRPVNCNTTHYRANW Sbjct: 45 FPSHDVVKRRPVNCNTTHYRANW 67 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 46.8 bits (106), Expect = 1e-05 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 506 VVKRRPVNCNTTHYRANW 453 VVKRRPVNCNTTHYRANW Sbjct: 4 VVKRRPVNCNTTHYRANW 21 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 46.8 bits (106), Expect = 1e-05 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -1 Query: 506 VVKRRPVNCNTTHYRANW 453 VVKRRPVNCNTTHYRANW Sbjct: 4 VVKRRPVNCNTTHYRANW 21 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 44.4 bits (100), Expect = 6e-05 Identities = 20/23 (86%), Positives = 20/23 (86%) Frame = +3 Query: 438 GGARYPIRPIVSRITIHWPSFYN 506 GGA PIRPIVS ITIHWPSFYN Sbjct: 38 GGA--PIRPIVSHITIHWPSFYN 58 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 44.4 bits (100), Expect = 6e-05 Identities = 19/29 (65%), Positives = 21/29 (72%) Frame = +3 Query: 456 IRPIVSRITIHWPSFYNV*LGKPWRYPTL 542 +RP+VSRITIHW SFYNV GK P L Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNL 61 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 43.6 bits (98), Expect = 1e-04 Identities = 18/22 (81%), Positives = 18/22 (81%) Frame = -1 Query: 521 FSQSHVVKRRPVNCNTTHYRAN 456 F VVKRRPVNCNTTHYRAN Sbjct: 19 FRSHDVVKRRPVNCNTTHYRAN 40 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 42.3 bits (95), Expect = 2e-04 Identities = 21/39 (53%), Positives = 23/39 (58%) Frame = +3 Query: 426 PSPRGGARYPIRPIVSRITIHWPSFYNV*LGKPWRYPTL 542 P PR + P +SRITIHWPSFYNV GK P L Sbjct: 68 PPPRWSSN---SPYMSRITIHWPSFYNVVTGKTLALPNL 103 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 41.9 bits (94), Expect = 3e-04 Identities = 19/30 (63%), Positives = 21/30 (70%) Frame = +3 Query: 456 IRPIVSRITIHWPSFYNV*LGKPWRYPTLN 545 IRPIVSRITIHWPSFY + W P +N Sbjct: 18 IRPIVSRITIHWPSFYK---RRDWENPGVN 44 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 40.7 bits (91), Expect = 8e-04 Identities = 17/23 (73%), Positives = 17/23 (73%) Frame = -1 Query: 524 GFSQSHVVKRRPVNCNTTHYRAN 456 GF KRRPVNCNTTHYRAN Sbjct: 75 GFPSHDGEKRRPVNCNTTHYRAN 97 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 39.1 bits (87), Expect = 0.002 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = +1 Query: 487 TGRRFTTCDWENPGVTQL 540 TGRRFT DWENPGVTQL Sbjct: 40 TGRRFTRRDWENPGVTQL 57 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = +3 Query: 471 SRITIHWPSFYNV*LGKPWRYPTL 542 SRITIHWPSFYNV GK P L Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNL 25 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = +3 Query: 471 SRITIHWPSFYNV*LGKPWRYPTL 542 SRITIHWPSFYNV GK P L Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNL 25 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = +3 Query: 471 SRITIHWPSFYNV*LGKPWRYPTL 542 SRITIHWPSFYNV GK P L Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNL 25 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = +3 Query: 471 SRITIHWPSFYNV*LGKPWRYPTL 542 SRITIHWPSFYNV GK P L Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNL 25 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = +3 Query: 471 SRITIHWPSFYNV*LGKPWRYPTL 542 SRITIHWPSFYNV GK P L Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNL 25 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 39.1 bits (87), Expect = 0.002 Identities = 17/24 (70%), Positives = 17/24 (70%) Frame = +3 Query: 471 SRITIHWPSFYNV*LGKPWRYPTL 542 SRITIHWPSFYNV GK P L Sbjct: 2 SRITIHWPSFYNVVTGKTLALPNL 25 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 37.9 bits (84), Expect = 0.005 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 471 SRITIHWPSFYNV*LGKPWRYPTLN 545 SRITIHWPSFYNV GK LN Sbjct: 2 SRITIHWPSFYNVVTGKTLSVTQLN 26 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 37.1 bits (82), Expect = 0.009 Identities = 18/25 (72%), Positives = 19/25 (76%), Gaps = 1/25 (4%) Frame = +3 Query: 471 SRITIHWPSFYNV*LGK-PWRYPTL 542 SRITIHWPSFYNV GK R P+L Sbjct: 2 SRITIHWPSFYNVVTGKNTGREPSL 26 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 37.1 bits (82), Expect = 0.009 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 471 SRITIHWPSFYNV*LGKPWRYPTLN 545 SRITIHWPSFYNV GK LN Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLN 26 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 37.1 bits (82), Expect = 0.009 Identities = 17/25 (68%), Positives = 17/25 (68%) Frame = +3 Query: 471 SRITIHWPSFYNV*LGKPWRYPTLN 545 SRITIHWPSFYNV GK LN Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLN 26 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 36.7 bits (81), Expect = 0.012 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 471 SRITIHWPSFYNV*LGK 521 SRITIHWPSFYNV GK Sbjct: 2 SRITIHWPSFYNVVTGK 18 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 36.3 bits (80), Expect = 0.016 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 471 SRITIHWPSFYNV*LGK 521 SRITIHWPSFYNV L K Sbjct: 2 SRITIHWPSFYNVMLAK 18 >SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -1 Query: 539 SWVTPGFSQSHVVKRRPV 486 SWVTPGFSQS KRRPV Sbjct: 31 SWVTPGFSQSRRCKRRPV 48 >SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -1 Query: 539 SWVTPGFSQSHVVKRRPV 486 SWVTPGFSQS KRRPV Sbjct: 31 SWVTPGFSQSRRCKRRPV 48 >SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -1 Query: 539 SWVTPGFSQSHVVKRRPV 486 SWVTPGFSQS KRRPV Sbjct: 31 SWVTPGFSQSRRCKRRPV 48 >SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -1 Query: 539 SWVTPGFSQSHVVKRRPV 486 SWVTPGFSQS KRRPV Sbjct: 31 SWVTPGFSQSRRCKRRPV 48 >SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -1 Query: 539 SWVTPGFSQSHVVKRRPV 486 SWVTPGFSQS KRRPV Sbjct: 31 SWVTPGFSQSRRCKRRPV 48 >SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -1 Query: 539 SWVTPGFSQSHVVKRRPV 486 SWVTPGFSQS KRRPV Sbjct: 31 SWVTPGFSQSRRCKRRPV 48 >SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) Length = 107 Score = 35.5 bits (78), Expect = 0.029 Identities = 16/19 (84%), Positives = 17/19 (89%) Frame = -3 Query: 543 LKLGNARVFPVTRCKTTAS 487 +KLGNARVFPVT KTTAS Sbjct: 44 IKLGNARVFPVTTFKTTAS 62 >SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 35.5 bits (78), Expect = 0.029 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = -1 Query: 539 SWVTPGFSQSHVVKRRPV 486 SWVTPGFSQS KRRPV Sbjct: 31 SWVTPGFSQSRRCKRRPV 48 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 34.3 bits (75), Expect = 0.066 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 487 TGRRFTTCDWENPGVTQL 540 TGRR DWENPGVTQL Sbjct: 15 TGRRLQRRDWENPGVTQL 32 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 34.3 bits (75), Expect = 0.066 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 487 TGRRFTTCDWENPGVTQL 540 TGRR DWENPGVTQL Sbjct: 35 TGRRLQRRDWENPGVTQL 52 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 34.3 bits (75), Expect = 0.066 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 487 TGRRFTTCDWENPGVTQL 540 TGRR DWENPGVTQL Sbjct: 25 TGRRLQRRDWENPGVTQL 42 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 34.3 bits (75), Expect = 0.066 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 487 TGRRFTTCDWENPGVTQL 540 TGRR DWENPGVTQL Sbjct: 45 TGRRLQRRDWENPGVTQL 62 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 34.3 bits (75), Expect = 0.066 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +3 Query: 471 SRITIHWPSFYNV 509 SRITIHWPSFYNV Sbjct: 2 SRITIHWPSFYNV 14 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 34.3 bits (75), Expect = 0.066 Identities = 14/18 (77%), Positives = 14/18 (77%) Frame = +1 Query: 487 TGRRFTTCDWENPGVTQL 540 TGRR DWENPGVTQL Sbjct: 72 TGRRLQRRDWENPGVTQL 89 >SB_44767| Best HMM Match : WD40 (HMM E-Value=0.074) Length = 532 Score = 32.3 bits (70), Expect = 0.27 Identities = 13/18 (72%), Positives = 13/18 (72%) Frame = +1 Query: 487 TGRRFTTCDWENPGVTQL 540 TGR DWENPGVTQL Sbjct: 344 TGRHLQRRDWENPGVTQL 361 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 30.3 bits (65), Expect = 1.1 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 486 HWPSFYNV*LGKPWRYPTL 542 HWPSFYNV GK P L Sbjct: 62 HWPSFYNVVTGKTLALPNL 80 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 30.3 bits (65), Expect = 1.1 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 486 HWPSFYNV*LGKPWRYPTL 542 HWPSFYNV GK P L Sbjct: 5 HWPSFYNVVTGKTLALPNL 23 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 30.3 bits (65), Expect = 1.1 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = +3 Query: 486 HWPSFYNV*LGKPWRYPTL 542 HWPSFYNV GK P L Sbjct: 57 HWPSFYNVVTGKTLALPNL 75 >SB_6110| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2051 Score = 29.9 bits (64), Expect = 1.4 Identities = 15/40 (37%), Positives = 23/40 (57%), Gaps = 6/40 (15%) Frame = -1 Query: 512 SHVVKRRPVNCNTTHYRANWVPG--PPSRRR----TPRDC 411 +++ +R PV+ H R+NWVP P S +R TP +C Sbjct: 365 AYLARRTPVSVLCEHLRSNWVPNEYPASMKRLFEWTPDEC 404 >SB_4878| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 598 Score = 29.9 bits (64), Expect = 1.4 Identities = 12/34 (35%), Positives = 19/34 (55%) Frame = -1 Query: 506 VVKRRPVNCNTTHYRANWVPGPPSRRRTPRDCSK 405 V+K+ P+ + +R +PGPP R P+ SK Sbjct: 496 VMKKIPIKRRSVPHRHRGIPGPPDNLRPPKKKSK 529 >SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) Length = 73 Score = 29.1 bits (62), Expect = 2.5 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -1 Query: 539 SWVTPGFSQSHVVKRRP 489 SWVTPGFSQS K P Sbjct: 31 SWVTPGFSQSRRCKTTP 47 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = +3 Query: 486 HWPSFYNV*LGKPWRYPTLN 545 HWPSFYNV GK LN Sbjct: 5 HWPSFYNVVTGKTLGVTQLN 24 >SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 43 DWENPGVTQL 52 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 70 DWENPGVTQL 79 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 52 DWENPGVTQL 61 >SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 44 DWENPGVTQL 53 >SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 70 DWENPGVTQL 79 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 75 DWENPGVTQL 84 >SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 46 DWENPGVTQL 55 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 66 DWENPGVTQL 75 >SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 78 DWENPGVTQL 87 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 54 DWENPGVTQL 63 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 43 DWENPGVTQL 52 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 33 DWENPGVTQL 42 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 58 DWENPGVTQL 67 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 67 DWENPGVTQL 76 >SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 61 DWENPGVTQL 70 >SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 77 DWENPGVTQL 86 >SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 65 DWENPGVTQL 74 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 48 DWENPGVTQL 57 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 224 DWENPGVTQL 233 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 119 DWENPGVTQL 128 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 57 DWENPGVTQL 66 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 36 DWENPGVTQL 45 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 24 DWENPGVTQL 33 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 55 DWENPGVTQL 64 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 389 DWENPGVTQL 398 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) Length = 198 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 115 DWENPGVTQL 124 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 91 DWENPGVTQL 100 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 47 DWENPGVTQL 56 >SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 16 DWENPGVTQL 25 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 26 DWENPGVTQL 35 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 46 DWENPGVTQL 55 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 111 DWENPGVTQL 120 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 53 DWENPGVTQL 62 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 348 DWENPGVTQL 357 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 88 DWENPGVTQL 97 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 58 DWENPGVTQL 67 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 24 DWENPGVTQL 33 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 67 DWENPGVTQL 76 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 51 DWENPGVTQL 60 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 142 DWENPGVTQL 151 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 71 DWENPGVTQL 80 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 47 DWENPGVTQL 56 >SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) Length = 295 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 151 DWENPGVTQL 160 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 841 DWENPGVTQL 850 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 24 DWENPGVTQL 33 >SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 68 DWENPGVTQL 77 >SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 42 DWENPGVTQL 51 >SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 81 DWENPGVTQL 90 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 75 DWENPGVTQL 84 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 64 DWENPGVTQL 73 >SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 77 DWENPGVTQL 86 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 73 DWENPGVTQL 82 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 264 DWENPGVTQL 273 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 122 DWENPGVTQL 131 >SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 58 DWENPGVTQL 67 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 44 DWENPGVTQL 53 >SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 45 DWENPGVTQL 54 >SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) Length = 192 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 109 DWENPGVTQL 118 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 122 DWENPGVTQL 131 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 47 DWENPGVTQL 56 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 28 DWENPGVTQL 37 >SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 66 DWENPGVTQL 75 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 45 DWENPGVTQL 54 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 42 DWENPGVTQL 51 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 19 DWENPGVTQL 28 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 27 DWENPGVTQL 36 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 404 DWENPGVTQL 413 >SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 53 DWENPGVTQL 62 >SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 62 DWENPGVTQL 71 >SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 44 DWENPGVTQL 53 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 127 DWENPGVTQL 136 >SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 63 DWENPGVTQL 72 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 73 DWENPGVTQL 82 >SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 76 DWENPGVTQL 85 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 422 DWENPGVTQL 431 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) Length = 174 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 119 DWENPGVTQL 128 >SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) Length = 157 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 75 DWENPGVTQL 84 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 64 DWENPGVTQL 73 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 54 DWENPGVTQL 63 >SB_53980| Best HMM Match : UCR_TM (HMM E-Value=9.9) Length = 140 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 57 DWENPGVTQL 66 >SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 169 DWENPGVTQL 178 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 73 DWENPGVTQL 82 >SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 60 DWENPGVTQL 69 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 96 DWENPGVTQL 105 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 45 DWENPGVTQL 54 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 71 DWENPGVTQL 80 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 50 DWENPGVTQL 59 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 193 DWENPGVTQL 202 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 42 DWENPGVTQL 51 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 48 DWENPGVTQL 57 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 62 DWENPGVTQL 71 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 59 DWENPGVTQL 68 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 42 DWENPGVTQL 51 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 43 DWENPGVTQL 52 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 57 DWENPGVTQL 66 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 47 DWENPGVTQL 56 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 140 DWENPGVTQL 149 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 49 DWENPGVTQL 58 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 92 DWENPGVTQL 101 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 30 DWENPGVTQL 39 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 161 DWENPGVTQL 170 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 348 DWENPGVTQL 357 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 65 DWENPGVTQL 74 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 29 DWENPGVTQL 38 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 55 DWENPGVTQL 64 >SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) Length = 301 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 117 DWENPGVTQL 126 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 94 DWENPGVTQL 103 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 44 DWENPGVTQL 53 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 68 DWENPGVTQL 77 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 302 DWENPGVTQL 311 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 65 DWENPGVTQL 74 >SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 66 DWENPGVTQL 75 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 24 DWENPGVTQL 33 >SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 44 DWENPGVTQL 53 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 419 DWENPGVTQL 428 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 103 DWENPGVTQL 112 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 59 DWENPGVTQL 68 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 51 DWENPGVTQL 60 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 101 DWENPGVTQL 110 >SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 51 DWENPGVTQL 60 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 219 DWENPGVTQL 228 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 51 DWENPGVTQL 60 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 221 DWENPGVTQL 230 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 41 DWENPGVTQL 50 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 56 DWENPGVTQL 65 >SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 46 DWENPGVTQL 55 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 51 DWENPGVTQL 60 >SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 238 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 155 DWENPGVTQL 164 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 53 DWENPGVTQL 62 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 43 DWENPGVTQL 52 >SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 63 DWENPGVTQL 72 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 48 DWENPGVTQL 57 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 83 DWENPGVTQL 92 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 203 DWENPGVTQL 212 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 61 DWENPGVTQL 70 >SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 40 DWENPGVTQL 49 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 94 DWENPGVTQL 103 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 30 DWENPGVTQL 39 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 57 DWENPGVTQL 66 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 195 DWENPGVTQL 204 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 65 DWENPGVTQL 74 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 75 DWENPGVTQL 84 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 58 DWENPGVTQL 67 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 65 DWENPGVTQL 74 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 108 DWENPGVTQL 117 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 84 DWENPGVTQL 93 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 104 DWENPGVTQL 113 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 81 DWENPGVTQL 90 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 48 DWENPGVTQL 57 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 57 DWENPGVTQL 66 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 671 DWENPGVTQL 680 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 56 DWENPGVTQL 65 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 45 DWENPGVTQL 54 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 36 DWENPGVTQL 45 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 154 DWENPGVTQL 163 >SB_46529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 46 DWENPGVTQL 55 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 37 DWENPGVTQL 46 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 67 DWENPGVTQL 76 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 96 DWENPGVTQL 105 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 44 DWENPGVTQL 53 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 108 DWENPGVTQL 117 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 51 DWENPGVTQL 60 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 27.9 bits (59), Expect = 5.7 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 511 DWENPGVTQL 540 DWENPGVTQL Sbjct: 1198 DWENPGVTQL 1207 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,480,762 Number of Sequences: 59808 Number of extensions: 397559 Number of successful extensions: 3914 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3772 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3901 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1252112599 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -