BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0770 (591 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A7SLK2 Cluster: Predicted protein; n=1; Nematostella ve... 34 2.9 UniRef50_Q8IK96 Cluster: Putative uncharacterized protein; n=1; ... 33 5.0 >UniRef50_A7SLK2 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 394 Score = 33.9 bits (74), Expect = 2.9 Identities = 17/56 (30%), Positives = 30/56 (53%) Frame = -2 Query: 326 RLSLKCLYCNVLIFFFHIIFINCQYTIVIFCKLYVHISELHIIIIKVTRFSSVFVL 159 RL + YC++ +F I C + I +C L+V I+ +H + + + S+FVL Sbjct: 280 RLFMIYAYCSLFVFI--TIVHACLFMIYAYCSLFVLITIVHARLFMIYAYCSLFVL 333 Score = 33.5 bits (73), Expect = 3.8 Identities = 15/49 (30%), Positives = 27/49 (55%) Frame = -2 Query: 305 YCNVLIFFFHIIFINCQYTIVIFCKLYVHISELHIIIIKVTRFSSVFVL 159 YC++ +F I C + I +C L+V I+ +H + + + S+FVL Sbjct: 87 YCSLFVFI--TIVHACLFMIYAYCSLFVLITIVHACLFMIYAYCSLFVL 133 >UniRef50_Q8IK96 Cluster: Putative uncharacterized protein; n=1; Plasmodium falciparum 3D7|Rep: Putative uncharacterized protein - Plasmodium falciparum (isolate 3D7) Length = 4638 Score = 33.1 bits (72), Expect = 5.0 Identities = 15/53 (28%), Positives = 29/53 (54%), Gaps = 1/53 (1%) Frame = -2 Query: 350 IQICNYY*RLSLKCLYCNVLIFFFHIIFINCQYTI-VIFCKLYVHISELHIII 195 I CN Y + ++CLY +L+FFF + Y I + K ++ ++ H+++ Sbjct: 2771 INFCNIYNDIIIECLYIQLLLFFFKYMIQTLSYEISKEYTKNFLCHTKRHLLV 2823 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 441,691,481 Number of Sequences: 1657284 Number of extensions: 7008415 Number of successful extensions: 15247 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14768 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15231 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 41073165837 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -