BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0770 (591 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY119187-1|AAM51047.1| 115|Drosophila melanogaster SD11171p pro... 29 4.7 AE014297-3055|AAN13887.1| 203|Drosophila melanogaster CG31174-P... 29 4.7 >AY119187-1|AAM51047.1| 115|Drosophila melanogaster SD11171p protein. Length = 115 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -2 Query: 263 NCQYTIVIFCKLYVHISELHIIIIKVTRFSSVFVLYCDGNV 141 NC Y + C+LY +IS+ H I +F FV++ + + Sbjct: 42 NCTYFMQNTCQLYQNISKSHPKIENSVKFDEDFVMHMEPEI 82 >AE014297-3055|AAN13887.1| 203|Drosophila melanogaster CG31174-PA protein. Length = 203 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/41 (31%), Positives = 22/41 (53%) Frame = -2 Query: 263 NCQYTIVIFCKLYVHISELHIIIIKVTRFSSVFVLYCDGNV 141 NC Y + C+LY +IS+ H I +F FV++ + + Sbjct: 42 NCTYFMQNTCQLYQNISKSHPKIENSVKFDEDFVMHMEPEI 82 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,134,538 Number of Sequences: 53049 Number of extensions: 337063 Number of successful extensions: 821 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 816 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 821 length of database: 24,988,368 effective HSP length: 81 effective length of database: 20,691,399 effective search space used: 2379510885 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -