BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0769 (577 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subu... 24 3.1 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 23 5.4 CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transpos... 23 7.1 >AJ292755-1|CAC00630.1| 837|Anopheles gambiae integrin beta subunit protein. Length = 837 Score = 24.2 bits (50), Expect = 3.1 Identities = 14/50 (28%), Positives = 24/50 (48%) Frame = -1 Query: 175 YDISDRDVFFFFN*IH*QSVVVNSRDTPACGPVITNYGIPVIISARIMLI 26 +D D F +N VVV +++ C P + GI + + A ++LI Sbjct: 733 FDEDDCRFEFSYNDSDQDKVVVTAQENRECPPKVFMLGIVLAVIAVVVLI 782 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 23.4 bits (48), Expect = 5.4 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = +1 Query: 229 VSLFYSAVIGNSITL 273 +++F +AVIGNSI L Sbjct: 144 ITIFVTAVIGNSIVL 158 >CR954257-14|CAJ14165.1| 1726|Anopheles gambiae BEL12_AG transposon polyprotein protein. Length = 1726 Score = 23.0 bits (47), Expect = 7.1 Identities = 7/16 (43%), Positives = 10/16 (62%) Frame = -3 Query: 80 RDYQLWNTSYYKCENH 33 +D LWN +CE+H Sbjct: 635 QDQNLWNVEERECEDH 650 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 516,019 Number of Sequences: 2352 Number of extensions: 8253 Number of successful extensions: 12 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 12 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 54665910 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -