BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0768 (549 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 23 2.7 AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein... 21 8.2 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.6 bits (46), Expect = 2.7 Identities = 11/33 (33%), Positives = 15/33 (45%) Frame = -2 Query: 113 TPVKSIKNIPAAPFVPTKSSLYNEWRTNKMSSP 15 TP K NI P KSS + ++N+ P Sbjct: 887 TPAKKATNIGGKPVAVVKSSAQSLLQSNQQHFP 919 >AY661557-1|AAT74557.1| 411|Apis mellifera yellow-f-like protein protein. Length = 411 Score = 21.0 bits (42), Expect = 8.2 Identities = 8/34 (23%), Positives = 20/34 (58%) Frame = -3 Query: 451 VVDRNTHKYAKKSPIQQKWRSAAAFFMNKTGEVD 350 ++D T K + P++ +++ +FF++ +VD Sbjct: 147 IIDLKTDKILRIYPLKSSDQTSDSFFVDLVIDVD 180 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 153,725 Number of Sequences: 438 Number of extensions: 3465 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 15704448 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -