BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0766 (210 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_01_0330 - 2591652-2592485 26 4.8 >05_01_0330 - 2591652-2592485 Length = 277 Score = 25.8 bits (54), Expect = 4.8 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = -2 Query: 185 EISHTQ*KH*DLSRNNFVGYLFMSNEQVNVQA 90 ++SH ++ D S+ N VGY M+ +VN+Q+ Sbjct: 199 KVSHCDREYADTSKTNLVGYT-MTLVEVNIQS 229 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 4,572,631 Number of Sequences: 37544 Number of extensions: 61779 Number of successful extensions: 119 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 119 length of database: 14,793,348 effective HSP length: 49 effective length of database: 12,953,692 effective search space used: 259073840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -