BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0766 (210 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskel... 23 1.3 CR954256-8|CAJ14149.1| 247|Anopheles gambiae putative signal pe... 20 9.1 >CR954257-12|CAJ14163.1| 1645|Anopheles gambiae putative cytoskeletal structural protein protein. Length = 1645 Score = 23.0 bits (47), Expect = 1.3 Identities = 12/34 (35%), Positives = 20/34 (58%) Frame = -2 Query: 185 EISHTQ*KH*DLSRNNFVGYLFMSNEQVNVQAVI 84 +I++ Q + LSR +VGYL M + +Q V+ Sbjct: 919 QINYHQVSNIRLSRGLYVGYLKMQSSVDVIQVVV 952 >CR954256-8|CAJ14149.1| 247|Anopheles gambiae putative signal peptidase protein. Length = 247 Score = 20.2 bits (40), Expect = 9.1 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +1 Query: 55 ICGYF*VIFRITACTF 102 ICGY IT CTF Sbjct: 11 ICGYIVQYGCITHCTF 26 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 204,694 Number of Sequences: 2352 Number of extensions: 3724 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 563,979 effective HSP length: 47 effective length of database: 453,435 effective search space used: 9975570 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -