BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0765 (599 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholi... 23 2.3 AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 22 5.3 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 21 7.0 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 21 7.0 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 9.2 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 21 9.2 >DQ026039-1|AAY87898.1| 427|Apis mellifera nicotinic acetylcholine receptor beta2subunit protein. Length = 427 Score = 23.0 bits (47), Expect = 2.3 Identities = 8/27 (29%), Positives = 14/27 (51%) Frame = -1 Query: 551 HLVTTSKDLDSLQ*CAIESFHGWAPKL 471 HL S + DS+ ++S+ W P + Sbjct: 94 HLTWKSSEFDSINSIRVKSYEIWVPDI 120 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/22 (36%), Positives = 13/22 (59%) Frame = +2 Query: 470 KAWGPIHENFQSHIIEANPNLY 535 K W P++EN++S + A Y Sbjct: 441 KTWLPVNENYKSLNLAAQKREY 462 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.4 bits (43), Expect = 7.0 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = -1 Query: 509 CAIESFHGWAPKLSSETSA*YVSVNVLDSVKVKSNLYGVAT 387 CA + A K+ + + Y + +VL K N+Y V T Sbjct: 424 CAAHTDSSGAMKIVNMLNQLYTAFDVLTDPKKNPNVYKVET 464 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.4 bits (43), Expect = 7.0 Identities = 12/41 (29%), Positives = 19/41 (46%) Frame = -1 Query: 509 CAIESFHGWAPKLSSETSA*YVSVNVLDSVKVKSNLYGVAT 387 CA + A K+ + + Y + +VL K N+Y V T Sbjct: 424 CAAHTDSSGAVKIVNMLNQLYTAFDVLTDPKKNPNVYKVET 464 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.0 bits (42), Expect = 9.2 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 272 K*ASQDYGKPQNSTERATVTYSH 204 K A D+ KP NS +T+ YS+ Sbjct: 283 KTAEFDWNKPINSGFYSTIMYSN 305 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.0 bits (42), Expect = 9.2 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = -1 Query: 272 K*ASQDYGKPQNSTERATVTYSH 204 K A D+ KP NS +T+ YS+ Sbjct: 283 KTAEFDWNKPINSGFYSTIMYSN 305 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 147,079 Number of Sequences: 438 Number of extensions: 2689 Number of successful extensions: 6 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17604432 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -