BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0763 (483 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bomb... 39 0.051 UniRef50_A5IJX3 Cluster: Surface antigen (D15) precursor; n=2; T... 32 7.8 UniRef50_A0PWU0 Cluster: Polyketide synthase Pks16_1; n=1; Mycob... 32 7.8 >UniRef50_A1XDB3 Cluster: STIP; n=1; Bombyx mori|Rep: STIP - Bombyx mori (Silk moth) Length = 782 Score = 39.1 bits (87), Expect = 0.051 Identities = 16/19 (84%), Positives = 18/19 (94%) Frame = +1 Query: 184 KICPLSFSPDLLSGSRFRS 240 + CPLSFSPDLLSGSRFR+ Sbjct: 393 RCCPLSFSPDLLSGSRFRT 411 >UniRef50_A5IJX3 Cluster: Surface antigen (D15) precursor; n=2; Thermotoga|Rep: Surface antigen (D15) precursor - Thermotoga petrophila RKU-1 Length = 711 Score = 31.9 bits (69), Expect = 7.8 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +2 Query: 200 VSRRIFSVDRVFDLLVESGSTALGKVSVSNTSGFSPESTYT 322 V RR+F ++ F ++ G+T + SG SP+ TYT Sbjct: 261 VQRRLFEGEKAFKEILFHGNTIFTDQELLKASGLSPDQTYT 301 >UniRef50_A0PWU0 Cluster: Polyketide synthase Pks16_1; n=1; Mycobacterium ulcerans Agy99|Rep: Polyketide synthase Pks16_1 - Mycobacterium ulcerans (strain Agy99) Length = 550 Score = 31.9 bits (69), Expect = 7.8 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 1/45 (2%) Frame = -3 Query: 325 SRVGALGAKTGGVANTDLTKSSASR-FYQQIENAIH*EDPARNSV 194 S VG G ++GGVA L +SAS F E+A+H +D N + Sbjct: 455 SVVGIAGIRSGGVAAVRLATASASEGFVMVAESALHADDAESNRI 499 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 440,616,269 Number of Sequences: 1657284 Number of extensions: 8086916 Number of successful extensions: 20421 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 20035 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 20420 length of database: 575,637,011 effective HSP length: 94 effective length of database: 419,852,315 effective search space used: 27710252790 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -