BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0763 (483 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81512-1|CAB04173.1| 601|Caenorhabditis elegans Hypothetical pr... 29 2.3 U12964-1|AAL02497.1| 465|Caenorhabditis elegans Hypothetical pr... 27 7.1 >Z81512-1|CAB04173.1| 601|Caenorhabditis elegans Hypothetical protein F25C8.1 protein. Length = 601 Score = 28.7 bits (61), Expect = 2.3 Identities = 16/40 (40%), Positives = 20/40 (50%) Frame = -2 Query: 272 YQEQCFQILPTDRKRDPLRRSGEKLSGQILPQYADKRSGN 153 YQ Q ++ILP K R +GE+L L D R GN Sbjct: 333 YQTQQYRILPYIAKTIAFRMAGEELQQAFLNISKDLRQGN 372 >U12964-1|AAL02497.1| 465|Caenorhabditis elegans Hypothetical protein F26F4.5 protein. Length = 465 Score = 27.1 bits (57), Expect = 7.1 Identities = 20/59 (33%), Positives = 27/59 (45%), Gaps = 1/59 (1%) Frame = -1 Query: 279 LTLPRAVL-PDSTNRSKTRSTEKIRRETQWANLTSIRRQTLGKHHRQRLLSFAMNEKFQ 106 L L AVL D R ++ I E W NLTS + TL R+ +L + EK + Sbjct: 300 LILKEAVLRKDEAERQLETISKSIYDEDDWVNLTSQHKNTL----RRNVLLMWVQEKLE 354 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,215,314 Number of Sequences: 27780 Number of extensions: 192781 Number of successful extensions: 468 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 458 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 468 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 892829112 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -