BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0763 (483 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family... 28 3.8 At5g43660.1 68418.m05336 expressed protein similar to unknown pr... 27 8.8 At1g07220.1 68414.m00768 expressed protein 27 8.8 >At4g04980.1 68417.m00724 hydroxyproline-rich glycoprotein family protein Common family members: At4g18570, At3g25690, At5g61090 [Arabidopsis thaliana] Length = 681 Score = 27.9 bits (59), Expect = 3.8 Identities = 12/31 (38%), Positives = 18/31 (58%) Frame = -1 Query: 276 TLPRAVLPDSTNRSKTRSTEKIRRETQWANL 184 ++P P + RS ++T K+RR Q ANL Sbjct: 370 SMPAPPAPPGSGRSLKKATSKLRRSAQIANL 400 >At5g43660.1 68418.m05336 expressed protein similar to unknown protein (gb|AAB72163.1) Length = 361 Score = 26.6 bits (56), Expect = 8.8 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -3 Query: 109 SIWFLNYRLFTLDQYLSRFHLIFNTYESDIILNCF 5 +I F NYR + + Y RF ++ ++L CF Sbjct: 70 AIRFKNYREWIMSNYQPRFRELYKLDPESLLLPCF 104 >At1g07220.1 68414.m00768 expressed protein Length = 507 Score = 26.6 bits (56), Expect = 8.8 Identities = 13/50 (26%), Positives = 22/50 (44%) Frame = -1 Query: 237 SKTRSTEKIRRETQWANLTSIRRQTLGKHHRQRLLSFAMNEKFQFGF*II 88 S T I+ W N +T+GK + + S +MN + + F +I Sbjct: 371 SPTDLCRSIKYAVDWGNSNPSEAETIGKRGQGYMESLSMNRVYDYMFHLI 420 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,516,753 Number of Sequences: 28952 Number of extensions: 178090 Number of successful extensions: 475 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 475 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 829097472 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -