BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0761 (698 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. 26 0.26 EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-deca... 23 3.2 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 23 3.2 AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 23 3.2 AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxyge... 22 5.5 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 22 5.5 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 22 5.5 >DQ342040-1|ABC69932.1| 822|Tribolium castaneum STIP protein. Length = 822 Score = 26.2 bits (55), Expect = 0.26 Identities = 16/44 (36%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = -1 Query: 386 STPYGSVDRSSPPSLPSNRCGSRNRS--TTSLAPPLYTGSASKR 261 S Y S++ ++PP P R S + T S PPLY +KR Sbjct: 720 SISYLSMENNAPPPPPPPRVESFAETVRTVSKIPPLYKDLVAKR 763 >EU019709-1|ABU25221.1| 540|Tribolium castaneum aspartate 1-decarboxylase protein. Length = 540 Score = 22.6 bits (46), Expect = 3.2 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +1 Query: 364 STDPYGVLPLWRSNDLN 414 + DPYG++ W ++ LN Sbjct: 141 AVDPYGLVAQWATDALN 157 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 22.6 bits (46), Expect = 3.2 Identities = 13/41 (31%), Positives = 16/41 (39%) Frame = -3 Query: 333 QMWISKQEYDESGPSIVHRKCF*THRGRCLQQPAAGCSIQA 211 Q + QEY PS +H G Q A C +QA Sbjct: 100 QQQMDGQEYRPDSPSSMHMANTAAPNGHQTQVVYASCKLQA 140 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.6 bits (46), Expect = 3.2 Identities = 9/25 (36%), Positives = 15/25 (60%) Frame = -1 Query: 344 LPSNRCGSRNRSTTSLAPPLYTGSA 270 LP++RC SR S + + P +G + Sbjct: 79 LPNSRCNSRESSDSLVQPRCPSGES 103 >AY052394-1|AAL15468.1| 228|Tribolium castaneum tryptophan oxygenase protein. Length = 228 Score = 21.8 bits (44), Expect = 5.5 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 610 FPTPRSWVWKLAASTRPHITPS*SATWTSV 521 F PRS++ L+ S R H+ SA T++ Sbjct: 193 FLIPRSYIPPLSTSMRSHLCNWGSANSTNI 222 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.8 bits (44), Expect = 5.5 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 610 FPTPRSWVWKLAASTRPHITPS*SATWTSV 521 F PRS++ L+ S R H+ SA T++ Sbjct: 353 FLIPRSYIPPLSTSMRSHLCNWGSANSTNI 382 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.8 bits (44), Expect = 5.5 Identities = 11/30 (36%), Positives = 17/30 (56%) Frame = -2 Query: 610 FPTPRSWVWKLAASTRPHITPS*SATWTSV 521 F PRS++ L+ S R H+ SA T++ Sbjct: 353 FLIPRSYIPPLSTSMRSHLCNWGSANSTNI 382 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,394 Number of Sequences: 336 Number of extensions: 4159 Number of successful extensions: 7 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18426585 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -