BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0760 (699 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC550.05 |nse1||Smc5-6 complex non-SMC subunit 1|Schizosacchar... 28 1.1 SPBC16E9.14c |||membrane transporter|Schizosaccharomyces pombe|c... 26 6.0 >SPCC550.05 |nse1||Smc5-6 complex non-SMC subunit 1|Schizosaccharomyces pombe|chr 3|||Manual Length = 232 Score = 28.3 bits (60), Expect = 1.1 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -2 Query: 464 EKNNSVHSFGFSF*GVSRIAEGRSHIHTSLV*YQPVSQ 351 E NNS+H+F F V +GR +H + PVSQ Sbjct: 52 ELNNSLHNFDFKIKRVQDQLDGRLTLHFQNLSGDPVSQ 89 >SPBC16E9.14c |||membrane transporter|Schizosaccharomyces pombe|chr 2|||Manual Length = 386 Score = 25.8 bits (54), Expect = 6.0 Identities = 14/44 (31%), Positives = 20/44 (45%) Frame = +2 Query: 176 WREYGDGFLVLKFTSCHHSFSFEYTYGNHSFFVSLLCVLLRVKL 307 WRE D FLV + T + F + F S+L + L + L Sbjct: 139 WRETLDSFLVWRHTCLRYPFGMQQMELLVDFSFSILLIFLGMNL 182 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,800,952 Number of Sequences: 5004 Number of extensions: 55651 Number of successful extensions: 111 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 111 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 323158234 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -