BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0758 (476 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 28 0.059 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 24 0.96 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 23 2.2 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 21 6.8 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 27.9 bits (59), Expect = 0.059 Identities = 21/56 (37%), Positives = 32/56 (57%), Gaps = 2/56 (3%) Frame = -3 Query: 459 CRGYYGNVVLNSNICTSGVAGVGIYRGDSGGP-LTINHQGKEWL-IGVSSFVARDG 298 C YYGN+++N+ +C + G + DSGGP L N + K + IG+ S+ A G Sbjct: 323 CYKYYGNIMVNA-MC-AYAKGKDACQMDSGGPVLWQNPRTKRLVNIGIISWGAECG 376 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 23.8 bits (49), Expect = 0.96 Identities = 11/34 (32%), Positives = 18/34 (52%) Frame = -3 Query: 384 RGDSGGPLTINHQGKEWLIGVSSFVARDGCELGF 283 + D GGPL++ ++ + G S F G E G+ Sbjct: 441 QSDDGGPLSLKNKVETTHSGTSLFRINLGIECGY 474 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 22.6 bits (46), Expect = 2.2 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -3 Query: 438 VVLNSNICTSGVAG 397 VV+ + ICTSG+ G Sbjct: 138 VVITAAICTSGIVG 151 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 21.0 bits (42), Expect = 6.8 Identities = 6/12 (50%), Positives = 9/12 (75%) Frame = +2 Query: 17 VDCHFIVKWLDR 52 +DC+F W+DR Sbjct: 53 MDCYFRQSWVDR 64 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 135,129 Number of Sequences: 438 Number of extensions: 3019 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 12928545 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -