BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0757 (472 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 28 3.3 02_01_0500 - 3623837-3624019,3624591-3624778,3625209-3626147,362... 28 3.3 09_02_0097 - 4232707-4232991,4233672-4233913,4234253-4234427 27 5.8 06_01_0559 - 3973261-3973778,3974694-3975591 27 5.8 08_01_0370 + 3275771-3275789,3275972-3276976,3277062-3277624 27 7.6 07_03_1436 - 26543846-26546806 27 7.6 03_02_0830 + 11611588-11611660,11611720-11611952 27 7.6 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 28.3 bits (60), Expect = 3.3 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -1 Query: 310 CILAVTSVTVLRHQAGGGSNTAK 242 C+L + S TVL GGGSN K Sbjct: 12 CLLLIVSSTVLHFSIGGGSNGEK 34 >02_01_0500 - 3623837-3624019,3624591-3624778,3625209-3626147, 3626311-3626479,3626701-3626871,3626948-3627016, 3627094-3627201,3627844-3627997,3628659-3628738, 3628822-3628914,3628951-3629073,3629165-3629915, 3630123-3630163,3630338-3630385 Length = 1038 Score = 28.3 bits (60), Expect = 3.3 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +3 Query: 330 KDWSLRNKKFVGKERRNSYHGQRRNRKRSNGHNRSFESKDSF 455 +D+ K +G R +HG +R RS+ +R +DS+ Sbjct: 131 RDFCFDRNKRIGSRDRAEFHGDFEDRYRSSHQSREDSREDSY 172 >09_02_0097 - 4232707-4232991,4233672-4233913,4234253-4234427 Length = 233 Score = 27.5 bits (58), Expect = 5.8 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +3 Query: 315 ELSPSKDWSLRNKKFVGKERRNSYH 389 EL P+ +R + F G+ER NSYH Sbjct: 32 ELHPNIIAIVREQPFSGRERENSYH 56 >06_01_0559 - 3973261-3973778,3974694-3975591 Length = 471 Score = 27.5 bits (58), Expect = 5.8 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -2 Query: 276 DTKQVEAVILQR*LLPFLQSWKCSVILTYSLCLFY 172 D +VEAV + FL++W+ + ++ CLF+ Sbjct: 246 DVLEVEAVAELPRAIGFLEAWRLPGVAPFAFCLFF 280 >08_01_0370 + 3275771-3275789,3275972-3276976,3277062-3277624 Length = 528 Score = 27.1 bits (57), Expect = 7.6 Identities = 12/39 (30%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = -2 Query: 228 FLQSWKCSVILTYSLCLFYRTRWHTYDRIFVI-FYVLET 115 FL++WK + ++LCLF+ ++ Y ++ + FY+ T Sbjct: 304 FLEAWKIPGVAPFALCLFF-SKLVAYTFLYWLPFYISHT 341 >07_03_1436 - 26543846-26546806 Length = 986 Score = 27.1 bits (57), Expect = 7.6 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 2/42 (4%) Frame = +1 Query: 337 GA*GIRSLWEKNDATLTTDKEETERGAT--VTIALLKVRTAL 456 G G+ SLW +T DKE E T +T+A ++R A+ Sbjct: 899 GPRGVISLWSDVKQAVTCDKESCEMAQTREITLAREEIRLAV 940 >03_02_0830 + 11611588-11611660,11611720-11611952 Length = 101 Score = 27.1 bits (57), Expect = 7.6 Identities = 19/63 (30%), Positives = 32/63 (50%) Frame = +3 Query: 189 CTSILRCISSSEERARVTFAVLLPPPAWCRKTVTEVTAKMQCELSPSKDWSLRNKKFVGK 368 CTS L + RAR T A++ PA + + ++ +LS S D S +++ +GK Sbjct: 10 CTSALASCHTDPMRARSTGALITEQPAVSLISNLPLHLCIRVDLSSSNDGSTSDRE-IGK 68 Query: 369 ERR 377 + R Sbjct: 69 KGR 71 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,887,830 Number of Sequences: 37544 Number of extensions: 249506 Number of successful extensions: 717 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 698 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 716 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 955200320 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -