BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0757 (472 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U50310-4|ABB51170.1| 409|Caenorhabditis elegans Hypothetical pr... 30 0.73 U50310-3|AAA92540.4| 411|Caenorhabditis elegans Hypothetical pr... 30 0.73 U42841-9|AAM97955.1| 375|Caenorhabditis elegans Gex interacting... 27 5.1 U42841-5|AAM97959.1| 657|Caenorhabditis elegans Gex interacting... 27 5.1 U42841-4|AAK77640.1| 706|Caenorhabditis elegans Gex interacting... 27 5.1 U42841-3|AAK77638.1| 663|Caenorhabditis elegans Gex interacting... 27 5.1 U42841-2|AAK77639.1| 603|Caenorhabditis elegans Gex interacting... 27 5.1 U42841-1|AAM97958.1| 716|Caenorhabditis elegans Gex interacting... 27 5.1 Z50006-7|CAA90302.2| 1461|Caenorhabditis elegans Hypothetical pr... 27 6.8 Z50004-4|CAA90293.2| 1461|Caenorhabditis elegans Hypothetical pr... 27 6.8 U42841-11|AAP31429.1| 394|Caenorhabditis elegans Gex interactin... 27 6.8 U42841-10|AAM97954.1| 380|Caenorhabditis elegans Gex interactin... 27 6.8 U42841-8|AAM97953.1| 476|Caenorhabditis elegans Gex interacting... 27 6.8 U42841-7|AAM97957.1| 447|Caenorhabditis elegans Gex interacting... 27 6.8 U42841-6|AAM97956.1| 404|Caenorhabditis elegans Gex interacting... 27 6.8 AB066246-1|BAC05514.1| 1461|Caenorhabditis elegans ADT-1 protein. 27 6.8 AF022982-3|AAB69932.1| 670|Caenorhabditis elegans Hypothetical ... 27 9.0 >U50310-4|ABB51170.1| 409|Caenorhabditis elegans Hypothetical protein ZC487.1b protein. Length = 409 Score = 30.3 bits (65), Expect = 0.73 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 181 AEAVRQYYAAFPALKKGQESPLQYYCLHLLGVVR 282 AEAVR FPA+ + PL+++C H +G +R Sbjct: 108 AEAVRNQIGGFPAVVR----PLRHHCAHSVGFIR 137 >U50310-3|AAA92540.4| 411|Caenorhabditis elegans Hypothetical protein ZC487.1a protein. Length = 411 Score = 30.3 bits (65), Expect = 0.73 Identities = 14/34 (41%), Positives = 21/34 (61%) Frame = +1 Query: 181 AEAVRQYYAAFPALKKGQESPLQYYCLHLLGVVR 282 AEAVR FPA+ + PL+++C H +G +R Sbjct: 108 AEAVRNQIGGFPAVVR----PLRHHCAHSVGFIR 137 >U42841-9|AAM97955.1| 375|Caenorhabditis elegans Gex interacting protein protein16, isoform g protein. Length = 375 Score = 27.5 bits (58), Expect = 5.1 Identities = 15/59 (25%), Positives = 28/59 (47%) Frame = +3 Query: 276 RKTVTEVTAKMQCELSPSKDWSLRNKKFVGKERRNSYHGQRRNRKRSNGHNRSFESKDS 452 + TVTE + + E +++ R ++ KERR+ +H R+ GH ++ S Sbjct: 70 KPTVTETVQRFE-ETRRTEEVERRVQRREKKERRSRHHSSSRHHSGWEGHTGGYQGHRS 127 >U42841-5|AAM97959.1| 657|Caenorhabditis elegans Gex interacting protein protein16, isoform k protein. Length = 657 Score = 27.5 bits (58), Expect = 5.1 Identities = 15/59 (25%), Positives = 28/59 (47%) Frame = +3 Query: 276 RKTVTEVTAKMQCELSPSKDWSLRNKKFVGKERRNSYHGQRRNRKRSNGHNRSFESKDS 452 + TVTE + + E +++ R ++ KERR+ +H R+ GH ++ S Sbjct: 352 KPTVTETVQRFE-ETRRTEEVERRVQRREKKERRSRHHSSSRHHSGWEGHTGGYQGHRS 409 >U42841-4|AAK77640.1| 706|Caenorhabditis elegans Gex interacting protein protein16, isoform c protein. Length = 706 Score = 27.5 bits (58), Expect = 5.1 Identities = 15/59 (25%), Positives = 28/59 (47%) Frame = +3 Query: 276 RKTVTEVTAKMQCELSPSKDWSLRNKKFVGKERRNSYHGQRRNRKRSNGHNRSFESKDS 452 + TVTE + + E +++ R ++ KERR+ +H R+ GH ++ S Sbjct: 401 KPTVTETVQRFE-ETRRTEEVERRVQRREKKERRSRHHSSSRHHSGWEGHTGGYQGHRS 458 >U42841-3|AAK77638.1| 663|Caenorhabditis elegans Gex interacting protein protein16, isoform a protein. Length = 663 Score = 27.5 bits (58), Expect = 5.1 Identities = 15/59 (25%), Positives = 28/59 (47%) Frame = +3 Query: 276 RKTVTEVTAKMQCELSPSKDWSLRNKKFVGKERRNSYHGQRRNRKRSNGHNRSFESKDS 452 + TVTE + + E +++ R ++ KERR+ +H R+ GH ++ S Sbjct: 358 KPTVTETVQRFE-ETRRTEEVERRVQRREKKERRSRHHSSSRHHSGWEGHTGGYQGHRS 415 >U42841-2|AAK77639.1| 603|Caenorhabditis elegans Gex interacting protein protein16, isoform b protein. Length = 603 Score = 27.5 bits (58), Expect = 5.1 Identities = 15/59 (25%), Positives = 28/59 (47%) Frame = +3 Query: 276 RKTVTEVTAKMQCELSPSKDWSLRNKKFVGKERRNSYHGQRRNRKRSNGHNRSFESKDS 452 + TVTE + + E +++ R ++ KERR+ +H R+ GH ++ S Sbjct: 298 KPTVTETVQRFE-ETRRTEEVERRVQRREKKERRSRHHSSSRHHSGWEGHTGGYQGHRS 355 >U42841-1|AAM97958.1| 716|Caenorhabditis elegans Gex interacting protein protein16, isoform j protein. Length = 716 Score = 27.5 bits (58), Expect = 5.1 Identities = 15/59 (25%), Positives = 28/59 (47%) Frame = +3 Query: 276 RKTVTEVTAKMQCELSPSKDWSLRNKKFVGKERRNSYHGQRRNRKRSNGHNRSFESKDS 452 + TVTE + + E +++ R ++ KERR+ +H R+ GH ++ S Sbjct: 411 KPTVTETVQRFE-ETRRTEEVERRVQRREKKERRSRHHSSSRHHSGWEGHTGGYQGHRS 468 >Z50006-7|CAA90302.2| 1461|Caenorhabditis elegans Hypothetical protein C02B4.1 protein. Length = 1461 Score = 27.1 bits (57), Expect = 6.8 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -1 Query: 145 NLRDLLCPGD*YTADQQC 92 +L DL PG +TADQQC Sbjct: 459 HLSDLRLPGQRFTADQQC 476 >Z50004-4|CAA90293.2| 1461|Caenorhabditis elegans Hypothetical protein C02B4.1 protein. Length = 1461 Score = 27.1 bits (57), Expect = 6.8 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -1 Query: 145 NLRDLLCPGD*YTADQQC 92 +L DL PG +TADQQC Sbjct: 459 HLSDLRLPGQRFTADQQC 476 >U42841-11|AAP31429.1| 394|Caenorhabditis elegans Gex interacting protein protein16, isoform l protein. Length = 394 Score = 27.1 bits (57), Expect = 6.8 Identities = 14/55 (25%), Positives = 27/55 (49%) Frame = +3 Query: 276 RKTVTEVTAKMQCELSPSKDWSLRNKKFVGKERRNSYHGQRRNRKRSNGHNRSFE 440 + TVTE + + E +++ R ++ KERR+ +H R+ GH ++ Sbjct: 28 KPTVTETVQRFE-ETRRTEEVERRVQRREKKERRSRHHSSSRHHSGWEGHTGGYQ 81 >U42841-10|AAM97954.1| 380|Caenorhabditis elegans Gex interacting protein protein16, isoform f protein. Length = 380 Score = 27.1 bits (57), Expect = 6.8 Identities = 14/55 (25%), Positives = 27/55 (49%) Frame = +3 Query: 276 RKTVTEVTAKMQCELSPSKDWSLRNKKFVGKERRNSYHGQRRNRKRSNGHNRSFE 440 + TVTE + + E +++ R ++ KERR+ +H R+ GH ++ Sbjct: 28 KPTVTETVQRFE-ETRRTEEVERRVQRREKKERRSRHHSSSRHHSGWEGHTGGYQ 81 >U42841-8|AAM97953.1| 476|Caenorhabditis elegans Gex interacting protein protein16, isoform e protein. Length = 476 Score = 27.1 bits (57), Expect = 6.8 Identities = 14/55 (25%), Positives = 27/55 (49%) Frame = +3 Query: 276 RKTVTEVTAKMQCELSPSKDWSLRNKKFVGKERRNSYHGQRRNRKRSNGHNRSFE 440 + TVTE + + E +++ R ++ KERR+ +H R+ GH ++ Sbjct: 124 KPTVTETVQRFE-ETRRTEEVERRVQRREKKERRSRHHSSSRHHSGWEGHTGGYQ 177 >U42841-7|AAM97957.1| 447|Caenorhabditis elegans Gex interacting protein protein16, isoform i protein. Length = 447 Score = 27.1 bits (57), Expect = 6.8 Identities = 14/55 (25%), Positives = 27/55 (49%) Frame = +3 Query: 276 RKTVTEVTAKMQCELSPSKDWSLRNKKFVGKERRNSYHGQRRNRKRSNGHNRSFE 440 + TVTE + + E +++ R ++ KERR+ +H R+ GH ++ Sbjct: 95 KPTVTETVQRFE-ETRRTEEVERRVQRREKKERRSRHHSSSRHHSGWEGHTGGYQ 148 >U42841-6|AAM97956.1| 404|Caenorhabditis elegans Gex interacting protein protein16, isoform h protein. Length = 404 Score = 27.1 bits (57), Expect = 6.8 Identities = 14/55 (25%), Positives = 27/55 (49%) Frame = +3 Query: 276 RKTVTEVTAKMQCELSPSKDWSLRNKKFVGKERRNSYHGQRRNRKRSNGHNRSFE 440 + TVTE + + E +++ R ++ KERR+ +H R+ GH ++ Sbjct: 52 KPTVTETVQRFE-ETRRTEEVERRVQRREKKERRSRHHSSSRHHSGWEGHTGGYQ 105 >AB066246-1|BAC05514.1| 1461|Caenorhabditis elegans ADT-1 protein. Length = 1461 Score = 27.1 bits (57), Expect = 6.8 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -1 Query: 145 NLRDLLCPGD*YTADQQC 92 +L DL PG +TADQQC Sbjct: 459 HLSDLRLPGQRFTADQQC 476 >AF022982-3|AAB69932.1| 670|Caenorhabditis elegans Hypothetical protein T23B12.6 protein. Length = 670 Score = 26.6 bits (56), Expect = 9.0 Identities = 9/22 (40%), Positives = 16/22 (72%), Gaps = 2/22 (9%) Frame = -2 Query: 210 CSVILTYS--LCLFYRTRWHTY 151 CS+++ YS +C++ T W+TY Sbjct: 217 CSIVVAYSYFVCVYRVTEWNTY 238 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,015,718 Number of Sequences: 27780 Number of extensions: 220833 Number of successful extensions: 679 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 661 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 679 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 850313440 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -