BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0754 (660 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_0926 + 7324145-7324561,7324773-7324778,7325255-7325311,732... 28 5.7 >01_01_0926 + 7324145-7324561,7324773-7324778,7325255-7325311, 7325572-7325661,7325938-7325982,7326088-7326142, 7326245-7326288,7326401-7326790,7327276-7327541, 7328292-7328430,7328514-7328564,7329158-7329642, 7329724-7330327,7330717-7331025 Length = 985 Score = 28.3 bits (60), Expect = 5.7 Identities = 14/61 (22%), Positives = 27/61 (44%) Frame = -1 Query: 420 G*REKIQFRKSESEKIDRASR*PLDRGERERTKPDRFCYTQHSLLQGKFDLRMRNKKQYT 241 G ++ F K+ +E D ++ R+ + CY QH + F L + ++K Y Sbjct: 99 GGEAEVAFNKTRAEGKDGRKGRSMELKSRKLNPINTICYVQHKGVYSGFPLPVEDQKYYV 158 Query: 240 I 238 + Sbjct: 159 V 159 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,541,445 Number of Sequences: 37544 Number of extensions: 192740 Number of successful extensions: 428 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 420 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 428 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1655832080 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -