BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0754 (660 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase ... 27 0.40 AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein ... 24 4.9 >AJ439060-7|CAD27758.1| 849|Anopheles gambiae putative V-ATPase protein. Length = 849 Score = 27.5 bits (58), Expect = 0.40 Identities = 11/38 (28%), Positives = 20/38 (52%) Frame = -3 Query: 253 KTIYYSVEVSYFSRAPICTLTIFILFYNVYIIDSLKEF 140 K I Y+ + Y R P C ++ I+F N+ + + + F Sbjct: 590 KWIAYTAKTDYQPRTPGCAPSVLIMFINMMLFKNSEPF 627 >AJ302654-1|CAC35519.1| 168|Anopheles gambiae gSG2-like protein protein. Length = 168 Score = 23.8 bits (49), Expect = 4.9 Identities = 9/22 (40%), Positives = 16/22 (72%) Frame = +2 Query: 545 MTKLNTLSITLIDNNNAHHYAR 610 +T L+TLS+ ++ AHH++R Sbjct: 5 LTLLSTLSVAMVFALPAHHHSR 26 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 512,093 Number of Sequences: 2352 Number of extensions: 8355 Number of successful extensions: 14 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 65650335 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -