BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0754 (660 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L46861-1|AAA74747.1| 2553|Caenorhabditis elegans talin protein. 48 6e-06 AC025726-18|AAK73910.1| 996|Caenorhabditis elegans Hypothetical... 48 6e-06 AC025726-17|AAK73909.2| 2553|Caenorhabditis elegans Hypothetical... 48 6e-06 Z93373-2|CAN99669.1| 1671|Caenorhabditis elegans Hypothetical pr... 27 8.9 Z93373-1|CAB07551.1| 1601|Caenorhabditis elegans Hypothetical pr... 27 8.9 Z70204-3|CAA94113.1| 385|Caenorhabditis elegans Hypothetical pr... 27 8.9 >L46861-1|AAA74747.1| 2553|Caenorhabditis elegans talin protein. Length = 2553 Score = 48.0 bits (109), Expect = 6e-06 Identities = 25/49 (51%), Positives = 29/49 (59%) Frame = -3 Query: 148 KEFLPASYVKVKGIEKKVFREHKKHVGLSELDAKVLYTKTARDLKTYGV 2 ++ LP Y K K EKKV +K+ G SELDAK Y R LKTYGV Sbjct: 290 RDVLPKEYAKNKENEKKVVAMYKELSGTSELDAKSKYVHLCRGLKTYGV 338 >AC025726-18|AAK73910.1| 996|Caenorhabditis elegans Hypothetical protein Y71G12B.11b protein. Length = 996 Score = 48.0 bits (109), Expect = 6e-06 Identities = 25/49 (51%), Positives = 29/49 (59%) Frame = -3 Query: 148 KEFLPASYVKVKGIEKKVFREHKKHVGLSELDAKVLYTKTARDLKTYGV 2 ++ LP Y K K EKKV +K+ G SELDAK Y R LKTYGV Sbjct: 290 RDVLPKEYAKNKENEKKVVAMYKELSGTSELDAKSKYVHLCRGLKTYGV 338 >AC025726-17|AAK73909.2| 2553|Caenorhabditis elegans Hypothetical protein Y71G12B.11a protein. Length = 2553 Score = 48.0 bits (109), Expect = 6e-06 Identities = 25/49 (51%), Positives = 29/49 (59%) Frame = -3 Query: 148 KEFLPASYVKVKGIEKKVFREHKKHVGLSELDAKVLYTKTARDLKTYGV 2 ++ LP Y K K EKKV +K+ G SELDAK Y R LKTYGV Sbjct: 290 RDVLPKEYAKNKENEKKVVAMYKELSGTSELDAKSKYVHLCRGLKTYGV 338 >Z93373-2|CAN99669.1| 1671|Caenorhabditis elegans Hypothetical protein C01B9.1b protein. Length = 1671 Score = 27.5 bits (58), Expect = 8.9 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = -3 Query: 163 IIDSLKEFLPASYVKVKGIEKKVFREHKKHVG--LSELDAKVLYTKTARD 20 +++ + + L +S VK+K ++F + LS+LD KVL KT D Sbjct: 112 LLEEMAKMLKSSNVKLKKFSVRLFETPSDPIEKILSDLDVKVLVLKTDWD 161 >Z93373-1|CAB07551.1| 1601|Caenorhabditis elegans Hypothetical protein C01B9.1a protein. Length = 1601 Score = 27.5 bits (58), Expect = 8.9 Identities = 16/50 (32%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = -3 Query: 163 IIDSLKEFLPASYVKVKGIEKKVFREHKKHVG--LSELDAKVLYTKTARD 20 +++ + + L +S VK+K ++F + LS+LD KVL KT D Sbjct: 42 LLEEMAKMLKSSNVKLKKFSVRLFETPSDPIEKILSDLDVKVLVLKTDWD 91 >Z70204-3|CAA94113.1| 385|Caenorhabditis elegans Hypothetical protein C11G6.3 protein. Length = 385 Score = 27.5 bits (58), Expect = 8.9 Identities = 17/52 (32%), Positives = 28/52 (53%) Frame = -1 Query: 531 DKNQRKNHNRTLTPHIATAN*RERQKFSEKL*QQIRYG*REKIQFRKSESEK 376 ++++RK R L + +ER+K EK ++ R REK + R+ E EK Sbjct: 211 ERSERKEKERELEREKEKSREKEREKEREKEREKEREKEREKQKEREKEREK 262 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,454,228 Number of Sequences: 27780 Number of extensions: 196363 Number of successful extensions: 542 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 527 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 541 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1476380920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -