BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0753 (615 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46399| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.56 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 27 9.1 >SB_46399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 358 Score = 31.5 bits (68), Expect = 0.56 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = -1 Query: 300 HYKTTTVTHFSPPDFVSTSSYPLCPFSPLSP 208 +Y TTTVT+ + +TSS P P +PL+P Sbjct: 302 YYDTTTVTNGNASSNETTSSAPASPMTPLTP 332 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 27.5 bits (58), Expect = 9.1 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +1 Query: 175 LTNHCSRDKAPRGKRRKWAQWVRGGGDEVRRGKMSNSGCFIVSTYQYLKKS 327 LT+ C + + W +WV+ V RG +S F T +YLK++ Sbjct: 325 LTHLCDEIEGFPSPQDFWEKWVKPSRALVLRGAAKHSEAFTKWTDEYLKEN 375 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,433,036 Number of Sequences: 59808 Number of extensions: 349873 Number of successful extensions: 760 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 688 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 760 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1512078125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -