BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0753 (615 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton anti... 23 5.9 U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette... 23 7.8 U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette... 23 7.8 U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette... 23 7.8 AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 pr... 23 7.8 >EF014219-1|ABJ91581.1| 647|Anopheles gambiae cation proton antiporter protein. Length = 647 Score = 23.4 bits (48), Expect = 5.9 Identities = 8/20 (40%), Positives = 10/20 (50%) Frame = -1 Query: 285 TVTHFSPPDFVSTSSYPLCP 226 T + PP + YPLCP Sbjct: 125 TTPSWEPPGWQKVCPYPLCP 144 >U29486-1|AAC46995.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.0 bits (47), Expect = 7.8 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -2 Query: 569 ATNYDDGLWNFFYCIL 522 +T Y W FYCIL Sbjct: 411 STGYRSSWWTQFYCIL 426 >U29485-1|AAC46994.1| 695|Anopheles gambiae ATP-binding-cassette protein protein. Length = 695 Score = 23.0 bits (47), Expect = 7.8 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -2 Query: 569 ATNYDDGLWNFFYCIL 522 +T Y W FYCIL Sbjct: 411 STGYRSSWWTQFYCIL 426 >U29484-1|AAC47423.1| 673|Anopheles gambiae ATP-binding-cassette protein protein. Length = 673 Score = 23.0 bits (47), Expect = 7.8 Identities = 8/16 (50%), Positives = 9/16 (56%) Frame = -2 Query: 569 ATNYDDGLWNFFYCIL 522 +T Y W FYCIL Sbjct: 389 STGYRSSWWTQFYCIL 404 >AJ271193-1|CAB66001.1| 1623|Anopheles gambiae laminin gamma 1 precursor protein. Length = 1623 Score = 23.0 bits (47), Expect = 7.8 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = +1 Query: 106 VLYNISYVKINAIFGLPCGNSHGLTNHCSRDKAPRGKRRKWAQWV 240 +L N++ VKI AI+G + + A RG + A W+ Sbjct: 649 ILSNLTAVKIRAIYG---DYGEAILDDVELQTAHRGAAGRQATWI 690 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 641,083 Number of Sequences: 2352 Number of extensions: 13061 Number of successful extensions: 59 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 57 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 59 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 60132501 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -