BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0753 (615 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41554-3|AAA83298.2| 745|Caenorhabditis elegans Nematode astaci... 31 0.49 AL132898-14|CAC14406.1| 1641|Caenorhabditis elegans Hypothetical... 31 0.86 Z81116-7|CAB03306.1| 669|Caenorhabditis elegans Hypothetical pr... 29 3.5 >U41554-3|AAA83298.2| 745|Caenorhabditis elegans Nematode astacin protease protein38 protein. Length = 745 Score = 31.5 bits (68), Expect = 0.49 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Frame = +1 Query: 85 PSTILYQVLYNISYVKINAIFGLPC-GNSHGLTNHCSRDKAPRGKRRKWAQWVRGGGDEV 261 PS + YQ + N++Y + LPC N + N+CS P G ++ + V + Sbjct: 297 PSFLDYQAI-NMAYGCTESCADLPCLRNGYTHPNNCSMCACPEGLSGRYCEQVYPSNAQC 355 Query: 262 RRGKMS 279 RGK++ Sbjct: 356 ARGKLT 361 >AL132898-14|CAC14406.1| 1641|Caenorhabditis elegans Hypothetical protein Y59A8B.1a protein. Length = 1641 Score = 30.7 bits (66), Expect = 0.86 Identities = 13/31 (41%), Positives = 18/31 (58%) Frame = +1 Query: 253 DEVRRGKMSNSGCFIVSTYQYLKKSELQRMH 345 +E RR +MS C +VST +K QR+H Sbjct: 1040 EEARRSRMSTRDCSVVSTLGPVKSKASQRLH 1070 >Z81116-7|CAB03306.1| 669|Caenorhabditis elegans Hypothetical protein T06C12.8 protein. Length = 669 Score = 28.7 bits (61), Expect = 3.5 Identities = 10/28 (35%), Positives = 19/28 (67%) Frame = +2 Query: 59 FAYPRQIQIQVQYYTKYYIIFLMSKLMP 142 FA+ + +++Q+Y +IFL+ K+MP Sbjct: 140 FAHTWSLSVEIQFYFLVPVIFLIGKVMP 167 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,984,715 Number of Sequences: 27780 Number of extensions: 278783 Number of successful extensions: 646 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 630 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 646 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1332243108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -