BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0753 (615 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 1.8 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 21 7.2 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 21 7.2 DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chlor... 21 9.6 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 9.6 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.4 bits (48), Expect = 1.8 Identities = 11/37 (29%), Positives = 15/37 (40%) Frame = +2 Query: 50 SNSFAYPRQIQIQVQYYTKYYIIFLMSKLMPFLDCPV 160 SN Y + Q +Y YY S +PF P+ Sbjct: 276 SNDLPYLEEFDWQKPFYPGYYPTMTYSNGLPFPQRPI 312 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 21.4 bits (43), Expect = 7.2 Identities = 10/37 (27%), Positives = 15/37 (40%) Frame = +2 Query: 50 SNSFAYPRQIQIQVQYYTKYYIIFLMSKLMPFLDCPV 160 SN + + Q +Y YY S +PF P+ Sbjct: 276 SNDLPHLEEFDWQKPFYPGYYPTMTYSNGLPFPQRPI 312 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 21.4 bits (43), Expect = 7.2 Identities = 6/12 (50%), Positives = 11/12 (91%) Frame = +2 Query: 524 EYNKKNSKDHHH 559 ++NK+ SK++HH Sbjct: 56 DHNKEKSKNNHH 67 >DQ667188-1|ABG75740.1| 383|Apis mellifera histamine-gated chloride channel protein. Length = 383 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/24 (33%), Positives = 14/24 (58%) Frame = +3 Query: 342 ALRYYVSCCSLYFISCLMEAEITN 413 A+ ++S CS++ LME + N Sbjct: 275 AIDVWMSSCSVFVFLSLMEFAVVN 298 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.0 bits (42), Expect = 9.6 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -1 Query: 288 TTVTHFSPPDFVST 247 TT+TH PD ST Sbjct: 308 TTITHLRDPDHHST 321 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,695 Number of Sequences: 438 Number of extensions: 4086 Number of successful extensions: 7 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 18215697 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -