BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0751 (618 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_01_0340 - 3734116-3734178,3734212-3734300,3734785-3734844,373... 28 6.8 >10_01_0340 - 3734116-3734178,3734212-3734300,3734785-3734844, 3736188-3736245,3736507-3736893,3736942-3737615, 3739154-3739203,3739903-3739943,3740721-3740860, 3740903-3741183,3741405-3741613 Length = 683 Score = 27.9 bits (59), Expect = 6.8 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = -2 Query: 530 SILHASFPVPICGDEVNTSDIVQVPRASMRRFMDRLM 420 S+LH SF P GD+ N ++ +P MD+++ Sbjct: 43 SLLHVSFGSPCLGDQRNREEMPGIPLERWSWGMDKML 79 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,801,451 Number of Sequences: 37544 Number of extensions: 215599 Number of successful extensions: 384 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 381 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 384 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1490248872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -