BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0751 (618 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z48621-7|CAA88546.1| 770|Caenorhabditis elegans Hypothetical pr... 29 2.7 U42833-4|AAA83579.1| 319|Caenorhabditis elegans Hypothetical pr... 29 2.7 >Z48621-7|CAA88546.1| 770|Caenorhabditis elegans Hypothetical protein R07B1.9 protein. Length = 770 Score = 29.1 bits (62), Expect = 2.7 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = -1 Query: 150 WCRGTPDSNEVPYYKNMNFKFCSRYKE 70 WC T D+N +P+YKN + KF + +E Sbjct: 263 WCLKTVDNNAMPFYKN-DLKFYYQGRE 288 >U42833-4|AAA83579.1| 319|Caenorhabditis elegans Hypothetical protein ZK430.2 protein. Length = 319 Score = 29.1 bits (62), Expect = 2.7 Identities = 16/48 (33%), Positives = 21/48 (43%) Frame = +3 Query: 408 SNIIH*PIHEPSHRGTWNLNDIGRVYFVSANGYRKRRVQYTTKHLQNN 551 + IIH P HE R W + G V A G ++ V T HL + Sbjct: 156 AGIIHQPYHEKLGRTVWAIQGCGVHGVVPATGNAQKIVVTTRSHLSES 203 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,012,693 Number of Sequences: 27780 Number of extensions: 217929 Number of successful extensions: 485 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 478 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 485 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1342816466 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -