BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0748 (598 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. 25 0.56 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.3 AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective... 22 5.3 AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. 21 6.9 AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C prot... 21 6.9 AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein ... 21 9.2 AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. 21 9.2 AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin prot... 21 9.2 AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin prot... 21 9.2 >AB072429-1|BAB83990.1| 388|Apis mellifera IP3phosphatase protein. Length = 388 Score = 25.0 bits (52), Expect = 0.56 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = -1 Query: 298 GSGYLFCSVPHLLHKVLLSHTDHHALMAGPSHDRGEHGARSIISC 164 GS Y+ VP +VLL+ TD + S D E+G +C Sbjct: 329 GSNYMQTRVPAWCDRVLLNPTDKMLVQDISSPDAVEYGIIGPTTC 373 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.0 bits (47), Expect = 2.3 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 379 LRVAPEEHPVLLTEAPLNPKANREKM 456 LR+ P H V+ T +NP + EK+ Sbjct: 1461 LRLGPCWHAVMTTYPRINPDNHNEKL 1486 >AB238796-1|BAE93398.1| 128|Apis mellifera Queen brain-selective protein-1 protein. Length = 128 Score = 21.8 bits (44), Expect = 5.3 Identities = 8/25 (32%), Positives = 10/25 (40%) Frame = +3 Query: 513 CSRCTRPVVPPVSCLDFPRRCLPHR 587 C++C C CLPHR Sbjct: 87 CNKCIGCSAEKFECSKTSNPCLPHR 111 >AF084556-1|AAC71015.1| 652|Apis mellifera pipsqueak protein. Length = 652 Score = 21.4 bits (43), Expect = 6.9 Identities = 10/22 (45%), Positives = 11/22 (50%) Frame = +2 Query: 518 SLYASGRTTGIVLGLPATVSPT 583 +LY R GI L P SPT Sbjct: 497 TLYKIARREGIRLAAPFNASPT 518 >AB013288-1|BAA87894.1| 149|Apis mellifera protein kinase C protein. Length = 149 Score = 21.4 bits (43), Expect = 6.9 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +2 Query: 143 GMCKAGFAGD 172 GMCK G +GD Sbjct: 130 GMCKEGISGD 139 >AF159569-1|AAF70859.1| 1124|Apis mellifera period clock protein protein. Length = 1124 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 202 DRGEHGARSIISCETGLA 149 D GEH ++ E GLA Sbjct: 130 DPGEHNGDTVTDVEAGLA 147 >AB086196-1|BAD06465.1| 289|Apis mellifera Period protein. Length = 289 Score = 21.0 bits (42), Expect = 9.2 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = -1 Query: 202 DRGEHGARSIISCETGLA 149 D GEH ++ E GLA Sbjct: 125 DPGEHNGDTVTDVEAGLA 142 >AB073998-1|BAC76402.1| 339|Apis mellifera preprotachykinin protein. Length = 339 Score = 21.0 bits (42), Expect = 9.2 Identities = 12/45 (26%), Positives = 20/45 (44%) Frame = +1 Query: 208 KAPPSGRDGRYGTEGLYVGDEAQSKRGILTLKYPIEHGIVTNWDD 342 K P G G G + + E KRG++ + ++ T +DD Sbjct: 180 KRAPMGFYGTRGKKIILDALEELDKRGVMDFQIGLQRKKDTTFDD 224 >AB073995-1|BAC76399.1| 301|Apis mellifera preprotachykinin protein. Length = 301 Score = 21.0 bits (42), Expect = 9.2 Identities = 12/45 (26%), Positives = 20/45 (44%) Frame = +1 Query: 208 KAPPSGRDGRYGTEGLYVGDEAQSKRGILTLKYPIEHGIVTNWDD 342 K P G G G + + E KRG++ + ++ T +DD Sbjct: 180 KRAPMGFYGTRGKKIILDALEELDKRGVMDFQIGLQRKKDTTFDD 224 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,703 Number of Sequences: 438 Number of extensions: 4400 Number of successful extensions: 11 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -