BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0746 (619 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) 109 2e-24 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 106 2e-23 SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) 106 2e-23 SB_4159| Best HMM Match : Vpu (HMM E-Value=2) 106 2e-23 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 7e-15 SB_25288| Best HMM Match : No HMM Matches (HMM E-Value=.) 78 7e-15 SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) 68 5e-12 SB_50727| Best HMM Match : adh_short (HMM E-Value=8.9e-08) 68 7e-12 SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 9e-12 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 66 2e-11 SB_31286| Best HMM Match : HEAT (HMM E-Value=0.092) 66 3e-11 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_51573| Best HMM Match : UCR_TM (HMM E-Value=6.7) 64 9e-11 SB_23924| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 9e-11 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 9e-11 SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 9e-11 SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 64 1e-10 SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 64 1e-10 SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 1e-10 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 63 2e-10 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 63 2e-10 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 63 2e-10 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 63 2e-10 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 63 2e-10 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 63 2e-10 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 63 2e-10 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 63 2e-10 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 63 2e-10 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 63 2e-10 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 63 2e-10 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 63 2e-10 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 63 2e-10 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 63 2e-10 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 63 2e-10 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 63 2e-10 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 63 2e-10 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 63 2e-10 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 63 2e-10 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 63 2e-10 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 63 2e-10 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_27913| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 63 2e-10 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 63 2e-10 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 63 2e-10 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 63 2e-10 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 63 2e-10 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 63 2e-10 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 63 2e-10 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 63 2e-10 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 63 2e-10 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 63 2e-10 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 63 2e-10 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 63 2e-10 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 63 2e-10 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 63 2e-10 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 63 2e-10 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 63 2e-10 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 63 2e-10 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 63 2e-10 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 63 2e-10 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 63 2e-10 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 63 2e-10 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 63 2e-10 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 63 2e-10 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 63 2e-10 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 63 2e-10 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 63 2e-10 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) 63 2e-10 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_31113| Best HMM Match : Herpes_U15 (HMM E-Value=8) 63 2e-10 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 63 2e-10 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_23954| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 63 2e-10 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 63 2e-10 SB_20169| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 63 2e-10 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 63 2e-10 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 63 2e-10 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 63 2e-10 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 63 2e-10 SB_5248| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 63 2e-10 SB_45174| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_50538| Best HMM Match : Moricin (HMM E-Value=4.5) 63 2e-10 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_18570| Best HMM Match : Moricin (HMM E-Value=6.5) 62 3e-10 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_45128| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 62 3e-10 SB_50436| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_48121| Best HMM Match : Kelch_1 (HMM E-Value=0.023) 62 3e-10 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 62 5e-10 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 62 5e-10 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 62 5e-10 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 62 5e-10 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 62 5e-10 SB_53831| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 62 5e-10 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 62 5e-10 SB_18115| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 62 5e-10 SB_6719| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_3766| Best HMM Match : Moricin (HMM E-Value=5.1) 62 5e-10 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 62 5e-10 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 61 6e-10 SB_31698| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_16934| Best HMM Match : Ldl_recept_b (HMM E-Value=1.7e-39) 61 6e-10 SB_51819| Best HMM Match : TGF_beta (HMM E-Value=1.9) 61 6e-10 SB_51757| Best HMM Match : Hormone_recep (HMM E-Value=6.4e-37) 61 6e-10 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 61 6e-10 SB_29937| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 61 6e-10 SB_29088| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_5886| Best HMM Match : DUF1205 (HMM E-Value=5.9) 61 6e-10 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 6e-10 SB_54947| Best HMM Match : rve (HMM E-Value=2.3e-31) 61 8e-10 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 8e-10 SB_22450| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 8e-10 SB_54100| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 8e-10 SB_37193| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 8e-10 SB_9475| Best HMM Match : PAN (HMM E-Value=0.0022) 61 8e-10 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 61 8e-10 SB_213| Best HMM Match : rve (HMM E-Value=2.2e-08) 61 8e-10 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 60 1e-09 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 60 1e-09 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 60 1e-09 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 60 1e-09 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56740| Best HMM Match : RBD (HMM E-Value=0.21) 60 1e-09 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56676| Best HMM Match : Peptidase_C1 (HMM E-Value=0.0027) 60 1e-09 SB_56581| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56546| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56496| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56465| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56281| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_55868| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_55798| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_55789| Best HMM Match : ERG2_Sigma1R (HMM E-Value=3.6e-10) 60 1e-09 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_55626| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_55099| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_55072| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_55011| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_54799| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_54508| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 60 1e-09 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_54170| Best HMM Match : Coronavirus_NS4 (HMM E-Value=6.1) 60 1e-09 SB_54136| Best HMM Match : YbgT_YccB (HMM E-Value=3) 60 1e-09 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 60 1e-09 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_53753| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_53515| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_52850| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 60 1e-09 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_52394| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_52253| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 60 1e-09 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_51654| Best HMM Match : Antirestrict (HMM E-Value=9.1) 60 1e-09 SB_51427| Best HMM Match : DUF855 (HMM E-Value=4) 60 1e-09 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_51214| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 60 1e-09 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50493| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50417| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_49931| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_49839| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_49465| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_49395| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_49150| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 60 1e-09 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 60 1e-09 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_48522| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_48116| Best HMM Match : Flu_NS2 (HMM E-Value=9.1) 60 1e-09 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 60 1e-09 SB_48066| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_48045| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47314| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47223| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 60 1e-09 >SB_12056| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 109 bits (261), Expect = 2e-24 Identities = 50/58 (86%), Positives = 50/58 (86%) Frame = -2 Query: 585 LRNCWEGRSVRASSLLRQLAKGGCAAGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 412 LRNCWEGRSVRASSLLRQLAKGGCAA GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 23 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 106 bits (254), Expect = 2e-23 Identities = 53/69 (76%), Positives = 55/69 (79%) Frame = -2 Query: 618 GFTNLPIRHSGLRNCWEGRSVRASSLLRQLAKGGCAAGD*VG*RQGFPSHDVVKRRPVNC 439 G ++ P R LRNCWEGRSVRASSLLRQLAKGGCAA GFPSHDVVKRRPVNC Sbjct: 586 GASHSPFR---LRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNC 639 Query: 438 NTTHYRANW 412 NTTHYRANW Sbjct: 640 NTTHYRANW 648 >SB_10526| Best HMM Match : CUE (HMM E-Value=6.5) Length = 281 Score = 106 bits (254), Expect = 2e-23 Identities = 53/69 (76%), Positives = 55/69 (79%) Frame = -2 Query: 618 GFTNLPIRHSGLRNCWEGRSVRASSLLRQLAKGGCAAGD*VG*RQGFPSHDVVKRRPVNC 439 G ++ P R LRNCWEGRSVRASSLLRQLAKGGCAA GFPSHDVVKRRPVNC Sbjct: 29 GASHSPFR---LRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNC 82 Query: 438 NTTHYRANW 412 NTTHYRANW Sbjct: 83 NTTHYRANW 91 >SB_4159| Best HMM Match : Vpu (HMM E-Value=2) Length = 779 Score = 106 bits (254), Expect = 2e-23 Identities = 53/69 (76%), Positives = 55/69 (79%) Frame = -2 Query: 618 GFTNLPIRHSGLRNCWEGRSVRASSLLRQLAKGGCAAGD*VG*RQGFPSHDVVKRRPVNC 439 G ++ P R LRNCWEGRSVRASSLLRQLAKGGCAA GFPSHDVVKRRPVNC Sbjct: 29 GASHSPFR---LRNCWEGRSVRASSLLRQLAKGGCAARRL---SWGFPSHDVVKRRPVNC 82 Query: 438 NTTHYRANW 412 NTTHYRANW Sbjct: 83 NTTHYRANW 91 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 77.8 bits (183), Expect = 7e-15 Identities = 42/53 (79%), Positives = 42/53 (79%), Gaps = 2/53 (3%) Frame = -2 Query: 597 RHSG--LRNCWEGRSVRASSLLRQLAKGGCAAGD*VG*RQGFPSHDVVKRRPV 445 RHS LRNCWEGRSVRASSLLRQLAKGGCAA GFPSHDVVKRRPV Sbjct: 18 RHSPFRLRNCWEGRSVRASSLLRQLAKGGCAAR---RLSWGFPSHDVVKRRPV 67 >SB_25288| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 77.8 bits (183), Expect = 7e-15 Identities = 39/53 (73%), Positives = 41/53 (77%), Gaps = 2/53 (3%) Frame = -1 Query: 598 SPF--RAAQLLGRAIGAGLFAITPAGERGMCCRRLSWVTPGFSQSRRCKTTAS 446 +PF +AA LLGRAIGAGLF ITPA ERGMC RRLSWV P FSQS RC AS Sbjct: 5 APFAIQAAHLLGRAIGAGLFDITPACERGMCARRLSWVMPAFSQSSRCIMAAS 57 >SB_17246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 602 Score = 68.5 bits (160), Expect = 4e-12 Identities = 31/39 (79%), Positives = 32/39 (82%), Gaps = 1/39 (2%) Frame = -2 Query: 525 KGGCAAGD*-VG*RQGFPSHDVVKRRPVNCNTTHYRANW 412 KG GD +G RQGFPSHDVVKRRPVNCNTTHYRANW Sbjct: 64 KGDVLQGDLKLGKRQGFPSHDVVKRRPVNCNTTHYRANW 102 Score = 50.4 bits (115), Expect = 1e-06 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = -1 Query: 595 PFRAAQLLGRAIGAGLFAITPAGERG 518 P +AAQLLGRAIGAGLFAITPAGE+G Sbjct: 40 PSQAAQLLGRAIGAGLFAITPAGEKG 65 >SB_58190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 68.1 bits (159), Expect = 5e-12 Identities = 36/54 (66%), Positives = 37/54 (68%), Gaps = 2/54 (3%) Frame = +2 Query: 446 TGRRFTTS*LGKPWRYPT*SPAAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 TGRRFT P AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 40 TGRRFTRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 >SB_50727| Best HMM Match : adh_short (HMM E-Value=8.9e-08) Length = 272 Score = 67.7 bits (158), Expect = 7e-12 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -3 Query: 602 PFAIQGCATVGKGDRCGPLRYYASWRKGDVLQ 507 P GCATVGKGDRCGPLRYYASWRKGDVLQ Sbjct: 239 PIRHSGCATVGKGDRCGPLRYYASWRKGDVLQ 270 >SB_39857| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 67.3 bits (157), Expect = 9e-12 Identities = 29/38 (76%), Positives = 33/38 (86%) Frame = -1 Query: 604 AHSPFRAAQLLGRAIGAGLFAITPAGERGMCCRRLSWV 491 +HSPFR +LLGRAIGAGLFAITPAGERGMCC+ + V Sbjct: 8 SHSPFRLRKLLGRAIGAGLFAITPAGERGMCCKAIKLV 45 >SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1907 Score = 66.9 bits (156), Expect = 1e-11 Identities = 30/37 (81%), Positives = 33/37 (89%) Frame = -1 Query: 589 RAAQLLGRAIGAGLFAITPAGERGMCCRRLSWVTPGF 479 +AAQLLGRAIGAGLFAITPAGERGMCC+ + VTP F Sbjct: 1841 QAAQLLGRAIGAGLFAITPAGERGMCCKAIKLVTPVF 1877 Score = 59.3 bits (137), Expect = 2e-09 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 480 FPSHDVVKRRPVNCNTTHYRANW 412 FPSHDVVKRRPVNCNTTHYRANW Sbjct: 1877 FPSHDVVKRRPVNCNTTHYRANW 1899 >SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) Length = 118 Score = 66.5 bits (155), Expect = 2e-11 Identities = 27/27 (100%), Positives = 27/27 (100%) Frame = -3 Query: 587 GCATVGKGDRCGPLRYYASWRKGDVLQ 507 GCATVGKGDRCGPLRYYASWRKGDVLQ Sbjct: 90 GCATVGKGDRCGPLRYYASWRKGDVLQ 116 Score = 59.7 bits (138), Expect = 2e-09 Identities = 29/32 (90%), Positives = 29/32 (90%), Gaps = 2/32 (6%) Frame = -2 Query: 597 RHSG--LRNCWEGRSVRASSLLRQLAKGGCAA 508 RHS LRNCWEGRSVRASSLLRQLAKGGCAA Sbjct: 18 RHSPFRLRNCWEGRSVRASSLLRQLAKGGCAA 49 Score = 57.6 bits (133), Expect = 8e-09 Identities = 30/53 (56%), Positives = 34/53 (64%), Gaps = 1/53 (1%) Frame = -1 Query: 601 HSPFRAAQLL-GRAIGAGLFAITPAGERGMCCRRLSWVTPGFSQSRRCKTTAS 446 HSPFR GR++ A + + G RRLSWVTPGFSQSRRCKTTAS Sbjct: 19 HSPFRLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 70 >SB_31286| Best HMM Match : HEAT (HMM E-Value=0.092) Length = 1270 Score = 65.7 bits (153), Expect = 3e-11 Identities = 30/47 (63%), Positives = 37/47 (78%) Frame = -1 Query: 589 RAAQLLGRAIGAGLFAITPAGERGMCCRRLSWVTPGFSQSRRCKTTA 449 +AAQLLGRAIGAGLFAITPAGERGMCC+ + TP ++R+ T+ Sbjct: 1127 QAAQLLGRAIGAGLFAITPAGERGMCCKAIKLDTPSSPRARKFGETS 1173 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 65.3 bits (152), Expect = 4e-11 Identities = 27/38 (71%), Positives = 30/38 (78%) Frame = -2 Query: 525 KGGCAAGD*VG*RQGFPSHDVVKRRPVNCNTTHYRANW 412 +G C +G +GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 22 RGMCCKAIKLGNAKGFPSHDVVKRRPVNCNTTHYRANW 59 Score = 46.4 bits (105), Expect = 2e-05 Identities = 21/37 (56%), Positives = 25/37 (67%) Frame = -3 Query: 584 CATVGKGDRCGPLRYYASWRKGDVLQAIKLGNARVFP 474 CATVGKGDRCG + +G +AIKLGNA+ FP Sbjct: 2 CATVGKGDRCGLFAITPAGERGMCCKAIKLGNAKGFP 38 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 65.3 bits (152), Expect = 4e-11 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 415 IRPIVSRITIHWPSFYNVVTGKTLALPNLIACSTSP 522 +RP+VSRITIHW SFYNVVTGKTLALPNLIA P Sbjct: 33 LRPVVSRITIHWTSFYNVVTGKTLALPNLIALQHIP 68 Score = 38.7 bits (86), Expect = 0.004 Identities = 18/32 (56%), Positives = 20/32 (62%) Frame = +3 Query: 507 LQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LQHIPLSPAGVIA+ +LNGEW Sbjct: 64 LQHIPLSPAGVIAEEARTDRPSQQLRSLNGEW 95 >SB_51573| Best HMM Match : UCR_TM (HMM E-Value=6.7) Length = 93 Score = 64.1 bits (149), Expect = 9e-11 Identities = 31/41 (75%), Positives = 33/41 (80%), Gaps = 2/41 (4%) Frame = +2 Query: 479 KPWRYPT*SPAAHPPFASWRNSEEARTDRPSQQLRS--PEW 595 +P P+ S AAHPPFASWRNSEEARTDRPSQQLRS EW Sbjct: 13 RPNPVPSPSDAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 53 >SB_23924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 64.1 bits (149), Expect = 9e-11 Identities = 33/55 (60%), Positives = 39/55 (70%), Gaps = 2/55 (3%) Frame = -1 Query: 598 SPF--RAAQLLGRAIGAGLFAITPAGERGMCCRRLSWVTPGFSQSRRCKTTASEL 440 +PF +AAQLLGRAIGAGLFAITPAGERGMCC+ + V F + K T E+ Sbjct: 10 APFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAIKLVITHFIECLCEKYTTGEM 64 >SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 64.1 bits (149), Expect = 9e-11 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 584 CATVGKGDRCGPLRYYASWRKGDVLQ 507 CATVGKGDRCGPLRYYASWRKGDVLQ Sbjct: 63 CATVGKGDRCGPLRYYASWRKGDVLQ 88 Score = 58.8 bits (136), Expect = 3e-09 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -2 Query: 585 LRNCWEGRSVRASSLLRQLAKGGCAA 508 LRNCWEGRSVRASSLLRQLAKGGCAA Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAA 27 Score = 52.0 bits (119), Expect = 4e-07 Identities = 25/42 (59%), Positives = 29/42 (69%) Frame = -1 Query: 571 GRAIGAGLFAITPAGERGMCCRRLSWVTPGFSQSRRCKTTAS 446 GR++ A + + G RRLSWVTPGFSQSRRCKTTAS Sbjct: 8 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTAS 48 >SB_15972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 64.1 bits (149), Expect = 9e-11 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 584 CATVGKGDRCGPLRYYASWRKGDVLQ 507 CATVGKGDRCGPLRYYASWRKGDVLQ Sbjct: 2 CATVGKGDRCGPLRYYASWRKGDVLQ 27 Score = 50.8 bits (116), Expect = 9e-07 Identities = 22/22 (100%), Positives = 22/22 (100%) Frame = -1 Query: 505 RLSWVTPGFSQSRRCKTTASEL 440 RLSWVTPGFSQSRRCKTTASEL Sbjct: 29 RLSWVTPGFSQSRRCKTTASEL 50 >SB_59549| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2631 Score = 63.7 bits (148), Expect = 1e-10 Identities = 31/42 (73%), Positives = 34/42 (80%), Gaps = 2/42 (4%) Frame = -1 Query: 619 RLYQFAHSPF--RAAQLLGRAIGAGLFAITPAGERGMCCRRL 500 RL F PF +AAQLLGRAIGAGLFAITPAGERGMCC+ + Sbjct: 1938 RLSVFGRVPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAI 1979 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 63.7 bits (148), Expect = 1e-10 Identities = 28/29 (96%), Positives = 29/29 (100%) Frame = -2 Query: 594 HSGLRNCWEGRSVRASSLLRQLAKGGCAA 508 +SGLRNCWEGRSVRASSLLRQLAKGGCAA Sbjct: 355 YSGLRNCWEGRSVRASSLLRQLAKGGCAA 383 Score = 57.2 bits (132), Expect = 1e-08 Identities = 29/61 (47%), Positives = 37/61 (60%), Gaps = 2/61 (3%) Frame = -1 Query: 616 LYQFAHSPFRAAQLL--GRAIGAGLFAITPAGERGMCCRRLSWVTPGFSQSRRCKTTASE 443 +Y + P+ + GR++ A + + G RRLSWVTPGFSQSRRCKTTASE Sbjct: 347 IYSYGRQPYSGLRNCWEGRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASE 405 Query: 442 L 440 L Sbjct: 406 L 406 >SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 63.7 bits (148), Expect = 1e-10 Identities = 33/47 (70%), Positives = 33/47 (70%) Frame = -2 Query: 585 LRNCWEGRSVRASSLLRQLAKGGCAAGD*VG*RQGFPSHDVVKRRPV 445 LRNCWEGRSVRASSLLRQLAKGGCAA GF KRRPV Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 63.7 bits (148), Expect = 1e-10 Identities = 25/26 (96%), Positives = 25/26 (96%) Frame = -2 Query: 489 RQGFPSHDVVKRRPVNCNTTHYRANW 412 R GFPSHDVVKRRPVNCNTTHYRANW Sbjct: 55 RSGFPSHDVVKRRPVNCNTTHYRANW 80 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 63.7 bits (148), Expect = 1e-10 Identities = 29/38 (76%), Positives = 33/38 (86%), Gaps = 2/38 (5%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRMGKLVK 616 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ + ++ Sbjct: 212 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRLMRYMR 249 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 191 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 242 >SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 63.7 bits (148), Expect = 1e-10 Identities = 33/47 (70%), Positives = 33/47 (70%) Frame = -2 Query: 585 LRNCWEGRSVRASSLLRQLAKGGCAAGD*VG*RQGFPSHDVVKRRPV 445 LRNCWEGRSVRASSLLRQLAKGGCAA GF KRRPV Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 63.7 bits (148), Expect = 1e-10 Identities = 33/47 (70%), Positives = 33/47 (70%) Frame = -2 Query: 585 LRNCWEGRSVRASSLLRQLAKGGCAAGD*VG*RQGFPSHDVVKRRPV 445 LRNCWEGRSVRASSLLRQLAKGGCAA GF KRRPV Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 63.7 bits (148), Expect = 1e-10 Identities = 33/47 (70%), Positives = 33/47 (70%) Frame = -2 Query: 585 LRNCWEGRSVRASSLLRQLAKGGCAAGD*VG*RQGFPSHDVVKRRPV 445 LRNCWEGRSVRASSLLRQLAKGGCAA GF KRRPV Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 63.7 bits (148), Expect = 1e-10 Identities = 33/47 (70%), Positives = 33/47 (70%) Frame = -2 Query: 585 LRNCWEGRSVRASSLLRQLAKGGCAAGD*VG*RQGFPSHDVVKRRPV 445 LRNCWEGRSVRASSLLRQLAKGGCAA GF KRRPV Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 63.7 bits (148), Expect = 1e-10 Identities = 33/47 (70%), Positives = 33/47 (70%) Frame = -2 Query: 585 LRNCWEGRSVRASSLLRQLAKGGCAAGD*VG*RQGFPSHDVVKRRPV 445 LRNCWEGRSVRASSLLRQLAKGGCAA GF KRRPV Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 63.7 bits (148), Expect = 1e-10 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 606 LPIRHSGLRNCWEGRSVRASSLLRQLAKGGCAA 508 +P SGLRNCWEGRSVRASSLLRQLAKGGCAA Sbjct: 76 MPEAVSGLRNCWEGRSVRASSLLRQLAKGGCAA 108 Score = 55.6 bits (128), Expect = 3e-08 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = -1 Query: 571 GRAIGAGLFAITPAGERGMCCRRLSWVTPGFSQSRRCKTTASEL 440 GR++ A + + G RRLSWVTPGFSQSRRCKTTASEL Sbjct: 89 GRSVRASSL-LRQLAKGGCAARRLSWVTPGFSQSRRCKTTASEL 131 >SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 63.7 bits (148), Expect = 1e-10 Identities = 33/47 (70%), Positives = 33/47 (70%) Frame = -2 Query: 585 LRNCWEGRSVRASSLLRQLAKGGCAAGD*VG*RQGFPSHDVVKRRPV 445 LRNCWEGRSVRASSLLRQLAKGGCAA GF KRRPV Sbjct: 2 LRNCWEGRSVRASSLLRQLAKGGCAARRLSWVTPGFSQSRRCKRRPV 48 >SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 36 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 68 Score = 45.6 bits (103), Expect = 3e-05 Identities = 23/48 (47%), Positives = 27/48 (56%) Frame = +3 Query: 459 LQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 19 LQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 66 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 83 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 113 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 46 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 78 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 25 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 76 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 70 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 100 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 49 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 79 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 37 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 67 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 50 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 82 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 29 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 80 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 39 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 69 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 37 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 67 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 854 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 886 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 833 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 884 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 37 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 67 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 135 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 167 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 114 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 165 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 60 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 90 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 41 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 71 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 32 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 64 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 11 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 62 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 40 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 70 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 109 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 139 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 58 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 88 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 27 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 59 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/26 (61%), Positives = 18/26 (69%) Frame = +1 Query: 445 HWPSFYNVVTGKTLALPNLIACSTSP 522 HWPSFYNVVTGKTL + L + P Sbjct: 5 HWPSFYNVVTGKTLGVTQLNRLAAHP 30 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 153 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 185 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 132 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 183 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 43 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 73 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 174 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 206 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 153 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 204 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 78 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 108 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 42 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 72 >SB_51515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 68 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 100 Score = 49.6 bits (113), Expect = 2e-06 Identities = 26/52 (50%), Positives = 30/52 (57%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 L VVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 47 LDVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 98 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 81 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 111 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 37 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 67 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 234 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 266 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 213 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 264 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 54 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 86 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 84 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 69 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 101 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 99 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 61 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 91 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 96 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 128 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 75 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 126 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 43 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 73 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 78 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 108 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 121 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 153 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 151 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 94 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 124 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 49 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 81 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 28 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 79 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 167 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 199 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 197 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 80 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 112 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 110 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 109 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 139 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 121 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 153 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 100 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 151 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 1211 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 1243 Score = 59.3 bits (137), Expect = 2e-09 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -2 Query: 618 GFTNLPIRHSGLRNCWEGRSVRASSLLRQLAKGGCAA 508 G ++ P R LRNCWEGRSVRASSLLRQLAKGGCAA Sbjct: 401 GASHSPFR---LRNCWEGRSVRASSLLRQLAKGGCAA 434 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 1190 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 1241 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 53 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 83 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 146 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 178 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 125 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 176 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 98 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 130 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 77 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 128 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 52 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 82 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 37 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 67 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 55 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 85 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 57 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 89 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 117 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 149 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 96 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 147 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 82 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 114 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 112 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 105 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 135 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 61 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 93 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 40 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 91 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 105 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 135 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 105 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 137 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 84 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 135 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 42 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 74 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 21 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 72 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 86 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 118 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 116 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 45 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 Score = 52.4 bits (120), Expect = 3e-07 Identities = 31/77 (40%), Positives = 38/77 (49%) Frame = +3 Query: 372 CRAISPCSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKR 551 C +P + G P+ LAVVLQRRDWENPGVTQLNRL P + ++ Sbjct: 1 CSPPTPTATGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEE 58 Query: 552 PAPIALPNSCAALNGEW 602 +LNGEW Sbjct: 59 ARTDRPSQQLRSLNGEW 75 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 129 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 161 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 159 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 37 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 67 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 45 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 75 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 64 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 96 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 94 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 97 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 129 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 76 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 127 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 88 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 120 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 67 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 118 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 112 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 144 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 91 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 142 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 62 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 92 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 1084 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 1116 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 1063 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 1114 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 38 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 68 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 52 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 82 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 155 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 187 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 134 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 185 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 203 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 235 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 182 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 233 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 191 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 223 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 170 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 221 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 80 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 112 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 59 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 110 >SB_37427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 56 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 88 Score = 45.6 bits (103), Expect = 3e-05 Identities = 23/48 (47%), Positives = 27/48 (56%) Frame = +3 Query: 459 LQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 39 LQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 86 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 40 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 72 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 19 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 70 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 167 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 199 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 146 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 197 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 79 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 109 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 137 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 169 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 116 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 167 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 44 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 76 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 23 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 74 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 673 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 705 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 652 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 703 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 60 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 90 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 182 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 214 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 161 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 212 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 68 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 100 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 47 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 98 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 53 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 85 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 32 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 83 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 43 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 73 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 79 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 109 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 91 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 123 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 121 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 38 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 68 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 81 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 113 Score = 58.8 bits (136), Expect = 3e-09 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS 586 +AHPPFASWRNSEEARTDRPSQQLRS Sbjct: 16 SAHPPFASWRNSEEARTDRPSQQLRS 41 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 60 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 111 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 92 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 124 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 122 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 100 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 132 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 130 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 206 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 238 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 185 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 236 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 465 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 497 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 444 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 495 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 94 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 124 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 287 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 319 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 266 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 317 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 41 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 71 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 55 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 85 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 82 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 114 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 61 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 112 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 91 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 123 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 70 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 121 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 125 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 157 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 155 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 84 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 116 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 114 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 94 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 124 >SB_27913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 444 Score = 63.3 bits (147), Expect = 2e-10 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = -1 Query: 589 RAAQLLGRAIGAGLFAITPAGERGMCCRRLSWVTP 485 +AAQLLGRAIGAGLFAITPAGERGMCC+ + V P Sbjct: 36 QAAQLLGRAIGAGLFAITPAGERGMCCKAIKLVEP 70 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 94 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 124 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 38 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 68 >SB_27498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 46 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 78 Score = 45.6 bits (103), Expect = 3e-05 Identities = 23/48 (47%), Positives = 27/48 (56%) Frame = +3 Query: 459 LQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 29 LQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 76 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 95 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 127 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 74 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 125 >SB_26118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 66 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 98 Score = 45.6 bits (103), Expect = 3e-05 Identities = 23/48 (47%), Positives = 27/48 (56%) Frame = +3 Query: 459 LQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 49 LQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 96 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 104 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 136 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 134 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 197 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 229 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 176 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 227 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 52 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 84 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 31 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 82 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 104 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 136 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 83 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 134 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 41 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 71 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 70 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 100 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 94 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 126 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 73 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 124 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 163 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 195 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 142 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 193 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 89 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 121 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 68 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 119 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 78 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 108 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 90 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 Score = 52.4 bits (120), Expect = 3e-07 Identities = 34/88 (38%), Positives = 42/88 (47%) Frame = +3 Query: 339 CWKGQT*CVSRCRAISPCSRGGPVXXXXXXXXXXXXLAVVLQRRDWENPGVTQLNRLQHI 518 C KG+ +S +S G P+ LAVVLQRRDWENPGVTQLNRL Sbjct: 35 CNKGEHYPISPAHRLSLPYEGDPLESTCRHASLA--LAVVLQRRDWENPGVTQLNRLAAH 92 Query: 519 PLSPAGVIAKRPAPIALPNSCAALNGEW 602 P + ++ +LNGEW Sbjct: 93 PPFASWRNSEEARTDRPSQQLRSLNGEW 120 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 41 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 71 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 37 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 67 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 59 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 91 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 89 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 65 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 97 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 95 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 83 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 113 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 102 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 132 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 108 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 140 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 87 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 138 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 125 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 157 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 104 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 155 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 59 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 91 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 38 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 89 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 71 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 103 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 50 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 101 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 70 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 102 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 49 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 100 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 62 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 94 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 41 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 92 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 43 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 75 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 22 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 73 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 41 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 71 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 147 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 179 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 177 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 64 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 96 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 43 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 94 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 90 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 120 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 76 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 106 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 39 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 69 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 75 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 107 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 54 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 105 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 109 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 141 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 88 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 139 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 76 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 106 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 79 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 109 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 41 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 71 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 115 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 147 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 94 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 145 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 86 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 118 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 65 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 116 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 188 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 220 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 167 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 218 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 83 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 115 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 62 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 113 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 63 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 95 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 42 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 93 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 38 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 70 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 17 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 68 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 54 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 86 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 33 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 84 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 100 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 132 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 79 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 130 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 78 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 110 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 57 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 108 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 55 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 85 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 126 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 158 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 105 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 156 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 67 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 99 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 46 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 97 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 57 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 89 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 36 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 140 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 172 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 119 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 170 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 173 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 205 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 152 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 203 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 123 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 155 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 102 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 153 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 55 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 85 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 47 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 77 >SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 116 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 148 Score = 48.8 bits (111), Expect = 3e-06 Identities = 26/52 (50%), Positives = 30/52 (57%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWEN GVTQLNRL P + ++ +LNGEW Sbjct: 95 LAVVLQRRDWENTGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 146 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 76 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 106 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 58 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 88 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 77 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 109 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 107 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 177 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 209 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 156 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 207 >SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) Length = 82 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 48 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 80 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 27 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 78 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 90 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 122 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 69 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 120 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 147 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 179 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 126 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 177 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 79 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 111 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 58 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 109 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 110 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 142 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 89 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 140 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 39 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 69 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 47 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 77 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 92 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 124 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 71 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 122 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 106 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 138 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 136 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 65 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 97 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 44 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 95 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 114 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 146 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 144 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 166 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 198 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 145 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 196 >SB_57017| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 93 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 125 Score = 45.6 bits (103), Expect = 3e-05 Identities = 23/48 (47%), Positives = 27/48 (56%) Frame = +3 Query: 459 LQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 76 LQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 123 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 812 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 844 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 791 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 842 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 93 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 125 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 72 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 123 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 114 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 146 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 93 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 144 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 76 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 108 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 55 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 106 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 128 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 160 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 107 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 158 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 37 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 67 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 102 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 132 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 129 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 161 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 108 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 159 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 37 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 67 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 327 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 359 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 306 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 357 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 51 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 83 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 30 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 81 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 73 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 105 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 52 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 103 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 36 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 68 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 15 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 66 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 47 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 79 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 26 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 77 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 74 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 106 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 53 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 104 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 37 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 67 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 77 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 109 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 56 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 107 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 268 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 300 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 247 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 298 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 102 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 134 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 81 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 132 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 55 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 87 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 34 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 85 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 69 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 101 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 48 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 99 >SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 37 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 67 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 45 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 77 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 24 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 75 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 225 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 257 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 204 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 255 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 84 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 116 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 63 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 114 >SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 39 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 71 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 18 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 69 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 56 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 88 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 35 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 86 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 740 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 772 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 719 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 770 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 60 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 92 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 39 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 90 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 550 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 582 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 529 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 580 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 58 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 90 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 37 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 88 >SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 37 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 67 >SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 551 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 208 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 240 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 187 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 238 >SB_31700| Best HMM Match : RNA_pol_Rpb1_R (HMM E-Value=6.8) Length = 126 Score = 63.3 bits (147), Expect = 2e-10 Identities = 30/40 (75%), Positives = 32/40 (80%), Gaps = 2/40 (5%) Frame = +2 Query: 482 PWRYPT*SPAAHPPFASWRNSEEARTDRPSQQLRS--PEW 595 P R+ + SP HPPFASWRNSEEARTDRPSQQLRS EW Sbjct: 48 PPRWSSNSPYTHPPFASWRNSEEARTDRPSQQLRSLNGEW 87 >SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 37 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 69 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 16 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 67 >SB_31113| Best HMM Match : Herpes_U15 (HMM E-Value=8) Length = 133 Score = 63.3 bits (147), Expect = 2e-10 Identities = 26/33 (78%), Positives = 28/33 (84%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRSPEWRMGK 607 A HPP ASWRNSEEARTDRPSQ+L EWRMG+ Sbjct: 99 AVHPPVASWRNSEEARTDRPSQELLQSEWRMGR 131 Score = 39.1 bits (87), Expect = 0.003 Identities = 19/28 (67%), Positives = 23/28 (82%), Gaps = 1/28 (3%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQ-HIPLS 527 LAVVLQRRDWEN GV+Q+ RL H P++ Sbjct: 78 LAVVLQRRDWENTGVSQVIRLAVHPPVA 105 >SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) Length = 511 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 136 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 168 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 115 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 166 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 51 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 83 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 30 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 81 >SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 41 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 73 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 20 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 71 >SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 63.3 bits (147), Expect = 2e-10 Identities = 29/33 (87%), Positives = 30/33 (90%), Gaps = 2/33 (6%) Frame = +2 Query: 509 AAHPPFASWRNSEEARTDRPSQQLRS--PEWRM 601 AAHPPFASWRNSEEARTDRPSQQLRS EWR+ Sbjct: 106 AAHPPFASWRNSEEARTDRPSQQLRSLNGEWRL 138 Score = 52.0 bits (119), Expect = 4e-07 Identities = 27/52 (51%), Positives = 31/52 (59%) Frame = +3 Query: 447 LAVVLQRRDWENPGVTQLNRLQHIPLSPAGVIAKRPAPIALPNSCAALNGEW 602 LAVVLQRRDWENPGVTQLNRL P + ++ +LNGEW Sbjct: 85 LAVVLQRRDWENPGVTQLNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEW 136 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,065,011 Number of Sequences: 59808 Number of extensions: 402192 Number of successful extensions: 7742 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 4735 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7697 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1524174750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -