BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= ce--0744 (708 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 23 1.8 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 23 2.4 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 23 2.4 AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory recept... 23 3.2 AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. 21 7.4 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 23.4 bits (48), Expect = 1.8 Identities = 14/36 (38%), Positives = 20/36 (55%) Frame = -2 Query: 176 TRLNYFWGLLFQITRFTFLYVSAQLGKLIIYLLLFC 69 T N FW L+ +T FL+ + LII L+L+C Sbjct: 227 TLANTFWSALYFLT-IIFLFF---IIPLIILLILYC 258 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 23.0 bits (47), Expect = 2.4 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +2 Query: 620 FKRNFISNRRKHFLNIFFKTKTR 688 F N I+ R+KHF + + ++ R Sbjct: 244 FSNNVIAERKKHFSSSSYSSRKR 266 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 23.0 bits (47), Expect = 2.4 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +2 Query: 620 FKRNFISNRRKHFLNIFFKTKTR 688 F N I+ R+KHF + + ++ R Sbjct: 244 FSNNVIAERKKHFSSSSYSSRKR 266 >AM292330-1|CAL23142.2| 408|Tribolium castaneum gustatory receptor candidate 9 protein. Length = 408 Score = 22.6 bits (46), Expect = 3.2 Identities = 11/40 (27%), Positives = 22/40 (55%) Frame = -2 Query: 170 LNYFWGLLFQITRFTFLYVSAQLGKLIIYLLLFC*VYRLV 51 LN F+ ++FQ+ +L+ + L + ++ L + RLV Sbjct: 294 LNNFYFIIFQVFESFYLHKATTLETVYYFISLGLLILRLV 333 >AY321476-1|AAQ23386.1| 253|Tribolium castaneum Ash protein. Length = 253 Score = 21.4 bits (43), Expect = 7.4 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = +3 Query: 78 QQIND*FTQLRTHIQKSKTSYLKEEAP 158 +Q+N+ F LR HI S + + P Sbjct: 99 KQVNNGFATLRQHIPASVAAAFAPQGP 125 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 158,522 Number of Sequences: 336 Number of extensions: 3248 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 18738900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -